Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE |
| Gene Sequence | GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE |
| Gene ID - Mouse | ENSMUSG00000022548 |
| Gene ID - Rat | ENSRNOG00000048273 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOD pAb (ATL-HPA040520 w/enhanced validation) | |
| Datasheet | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOD pAb (ATL-HPA040520 w/enhanced validation) | |
| Datasheet | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) |
| Citations for Anti APOD pAb (ATL-HPA040520 w/enhanced validation) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE |
| Gene Sequence | GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE |
| Gene ID - Mouse | ENSMUSG00000022548 |
| Gene ID - Rat | ENSRNOG00000048273 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOD pAb (ATL-HPA040520 w/enhanced validation) | |
| Datasheet | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOD pAb (ATL-HPA040520 w/enhanced validation) | |
| Datasheet | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOD pAb (ATL-HPA040520 w/enhanced validation) |
| Citations for Anti APOD pAb (ATL-HPA040520 w/enhanced validation) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |