Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK |
| Gene Sequence | ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK |
| Gene ID - Mouse | ENSMUSG00000000049 |
| Gene ID - Rat | ENSRNOG00000003566 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) | |
| Datasheet | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) | |
| Datasheet | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) |
| Citations for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) – 4 Found |
| Tanimura, Kenji; Jin, Hui; Suenaga, Tadahiro; Morikami, Satoko; Arase, Noriko; Kishida, Kazuki; Hirayasu, Kouyuki; Kohyama, Masako; Ebina, Yasuhiko; Yasuda, Shinsuke; Horita, Tetsuya; Takasugi, Kiyoshi; Ohmura, Koichiro; Yamamoto, Ken; Katayama, Ichiro; Sasazuki, Takehiko; Lanier, Lewis L; Atsumi, Tatsuya; Yamada, Hideto; Arase, Hisashi. β2-Glycoprotein I/HLA class II complexes are novel autoantigens in antiphospholipid syndrome. Blood. 2015;125(18):2835-44. PubMed |
| Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Zhang, Guiting; Cai, Qianqian; Zhou, Hong; He, Chao; Chen, Yudan; Zhang, Peng; Wang, Ting; Xu, Liangjie; Yan, Jinchuan. OxLDL/β2GPI/anti‑β2GPI Ab complex induces inflammatory activation via the TLR4/NF‑κB pathway in HUVECs. Molecular Medicine Reports. 2021;23(2) PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK |
| Gene Sequence | ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK |
| Gene ID - Mouse | ENSMUSG00000000049 |
| Gene ID - Rat | ENSRNOG00000003566 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) | |
| Datasheet | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) | |
| Datasheet | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOH pAb (ATL-HPA001654 w/enhanced validation) |
| Citations for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) – 4 Found |
| Tanimura, Kenji; Jin, Hui; Suenaga, Tadahiro; Morikami, Satoko; Arase, Noriko; Kishida, Kazuki; Hirayasu, Kouyuki; Kohyama, Masako; Ebina, Yasuhiko; Yasuda, Shinsuke; Horita, Tetsuya; Takasugi, Kiyoshi; Ohmura, Koichiro; Yamamoto, Ken; Katayama, Ichiro; Sasazuki, Takehiko; Lanier, Lewis L; Atsumi, Tatsuya; Yamada, Hideto; Arase, Hisashi. β2-Glycoprotein I/HLA class II complexes are novel autoantigens in antiphospholipid syndrome. Blood. 2015;125(18):2835-44. PubMed |
| Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Zhang, Guiting; Cai, Qianqian; Zhou, Hong; He, Chao; Chen, Yudan; Zhang, Peng; Wang, Ting; Xu, Liangjie; Yan, Jinchuan. OxLDL/β2GPI/anti‑β2GPI Ab complex induces inflammatory activation via the TLR4/NF‑κB pathway in HUVECs. Molecular Medicine Reports. 2021;23(2) PubMed |