Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EIAMCEPEFGNDKAREPSVGGRWRVSWYERF |
| Gene Sequence | EIAMCEPEFGNDKAREPSVGGRWRVSWYERF |
| Gene ID - Mouse | ENSMUSG00000030762 |
| Gene ID - Rat | ENSRNOG00000049985 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) | |
| Datasheet | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) | |
| Datasheet | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) |
| Citations for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) – 2 Found |
| Escudero-Hernández, Celia; Münch, Andreas; Østvik, Ann-Elisabet; Granlund, Atle van Beelen; Koch, Stefan. The Water Channel Aquaporin 8 is a Critical Regulator of Intestinal Fluid Homeostasis in Collagenous Colitis. Journal Of Crohn's & Colitis. 2020;14(7):962-973. PubMed |
| Pellavio, Giorgia; Sommi, Patrizia; Anselmi-Tamburini, Umberto; DeMichelis, Maria Paola; Coniglio, Stefania; Laforenza, Umberto. Cerium Oxide Nanoparticles Regulate Oxidative Stress in HeLa Cells by Increasing the Aquaporin-Mediated Hydrogen Peroxide Permeability. International Journal Of Molecular Sciences. 2022;23(18) PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EIAMCEPEFGNDKAREPSVGGRWRVSWYERF |
| Gene Sequence | EIAMCEPEFGNDKAREPSVGGRWRVSWYERF |
| Gene ID - Mouse | ENSMUSG00000030762 |
| Gene ID - Rat | ENSRNOG00000049985 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) | |
| Datasheet | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) | |
| Datasheet | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) |
| Citations for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) – 2 Found |
| Escudero-Hernández, Celia; Münch, Andreas; Østvik, Ann-Elisabet; Granlund, Atle van Beelen; Koch, Stefan. The Water Channel Aquaporin 8 is a Critical Regulator of Intestinal Fluid Homeostasis in Collagenous Colitis. Journal Of Crohn's & Colitis. 2020;14(7):962-973. PubMed |
| Pellavio, Giorgia; Sommi, Patrizia; Anselmi-Tamburini, Umberto; DeMichelis, Maria Paola; Coniglio, Stefania; Laforenza, Umberto. Cerium Oxide Nanoparticles Regulate Oxidative Stress in HeLa Cells by Increasing the Aquaporin-Mediated Hydrogen Peroxide Permeability. International Journal Of Molecular Sciences. 2022;23(18) PubMed |
Try browsing our complete catalog of products.