Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
| Gene Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
| Gene ID - Mouse | ENSMUSG00000025132 |
| Gene ID - Rat | ENSRNOG00000036688 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407) | |
| Datasheet | Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link) |
| Vendor Page | Anti ARHGDIA pAb (ATL-HPA021407) at Atlas Antibodies |
| Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407) | |
| Datasheet | Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link) |
| Vendor Page | Anti ARHGDIA pAb (ATL-HPA021407) |
| Citations for Anti ARHGDIA pAb (ATL-HPA021407) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
| Gene Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
| Gene ID - Mouse | ENSMUSG00000025132 |
| Gene ID - Rat | ENSRNOG00000036688 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407) | |
| Datasheet | Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link) |
| Vendor Page | Anti ARHGDIA pAb (ATL-HPA021407) at Atlas Antibodies |
| Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407) | |
| Datasheet | Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link) |
| Vendor Page | Anti ARHGDIA pAb (ATL-HPA021407) |
| Citations for Anti ARHGDIA pAb (ATL-HPA021407) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |