Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/42777/20594/atl-hpa008352_anti-arpc2-pab-atl-hpa008352_31246__33401.1783624814.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
| Gene Sequence | TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
| Gene ID - Mouse | ENSMUSG00000006304 |
| Gene ID - Rat | ENSRNOG00000014289 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARPC2 pAb (ATL-HPA008352) | |
| Datasheet | Anti ARPC2 pAb (ATL-HPA008352) Datasheet (External Link) |
| Vendor Page | Anti ARPC2 pAb (ATL-HPA008352) at Atlas Antibodies |
| Documents & Links for Anti ARPC2 pAb (ATL-HPA008352) | |
| Datasheet | Anti ARPC2 pAb (ATL-HPA008352) Datasheet (External Link) |
| Vendor Page | Anti ARPC2 pAb (ATL-HPA008352) |
| Citations for Anti ARPC2 pAb (ATL-HPA008352) – 4 Found |
| Pinto, Clyde Savio; Khandekar, Ameya; Bhavna, Rajasekaran; Kiesel, Petra; Pigino, Gaia; Sonawane, Mahendra. Microridges are apical epithelial projections formed of F-actin networks that organize the glycan layer. Scientific Reports. 2019;9(1):12191. PubMed |
| Zhao, Miao; Spiess, Matthias; Johansson, Henrik J; Olofsson, Helene; Hu, Jianjiang; Lehtiö, Janne; Strömblad, Staffan. Identification of the PAK4 interactome reveals PAK4 phosphorylation of N-WASP and promotion of Arp2/3-dependent actin polymerization. Oncotarget. 2017;8(44):77061-77074. PubMed |
| Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162. PubMed |
| Xu, Ming-Shu; Yin, Lei-Miao; Cheng, Ai-Fang; Zhang, Ying-Jie; Zhang, Di; Tao, Miao-Miao; Deng, Yun-Yi; Ge, Lin-Bao; Shan, Chun-Lei. Cerebral Ischemia-Reperfusion Is Associated With Upregulation of Cofilin-1 in the Motor Cortex. Frontiers In Cell And Developmental Biology. 9( 33777942):634347. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
| Gene Sequence | TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
| Gene ID - Mouse | ENSMUSG00000006304 |
| Gene ID - Rat | ENSRNOG00000014289 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARPC2 pAb (ATL-HPA008352) | |
| Datasheet | Anti ARPC2 pAb (ATL-HPA008352) Datasheet (External Link) |
| Vendor Page | Anti ARPC2 pAb (ATL-HPA008352) at Atlas Antibodies |
| Documents & Links for Anti ARPC2 pAb (ATL-HPA008352) | |
| Datasheet | Anti ARPC2 pAb (ATL-HPA008352) Datasheet (External Link) |
| Vendor Page | Anti ARPC2 pAb (ATL-HPA008352) |
| Citations for Anti ARPC2 pAb (ATL-HPA008352) – 4 Found |
| Pinto, Clyde Savio; Khandekar, Ameya; Bhavna, Rajasekaran; Kiesel, Petra; Pigino, Gaia; Sonawane, Mahendra. Microridges are apical epithelial projections formed of F-actin networks that organize the glycan layer. Scientific Reports. 2019;9(1):12191. PubMed |
| Zhao, Miao; Spiess, Matthias; Johansson, Henrik J; Olofsson, Helene; Hu, Jianjiang; Lehtiö, Janne; Strömblad, Staffan. Identification of the PAK4 interactome reveals PAK4 phosphorylation of N-WASP and promotion of Arp2/3-dependent actin polymerization. Oncotarget. 2017;8(44):77061-77074. PubMed |
| Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162. PubMed |
| Xu, Ming-Shu; Yin, Lei-Miao; Cheng, Ai-Fang; Zhang, Ying-Jie; Zhang, Di; Tao, Miao-Miao; Deng, Yun-Yi; Ge, Lin-Bao; Shan, Chun-Lei. Cerebral Ischemia-Reperfusion Is Associated With Upregulation of Cofilin-1 in the Motor Cortex. Frontiers In Cell And Developmental Biology. 9( 33777942):634347. PubMed |