Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
| Gene Sequence | YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
| Gene ID - Mouse | ENSMUSG00000040963 |
| Gene ID - Rat | ENSRNOG00000030726 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) | |
| Datasheet | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) | |
| Datasheet | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) |
| Citations for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) – 1 Found |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
| Gene Sequence | YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
| Gene ID - Mouse | ENSMUSG00000040963 |
| Gene ID - Rat | ENSRNOG00000030726 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) | |
| Datasheet | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) | |
| Datasheet | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) |
| Citations for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) – 1 Found |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |