Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS |
| Gene Sequence | MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS |
| Gene ID - Mouse | ENSMUSG00000076441 |
| Gene ID - Rat | ENSRNOG00000008837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) |
| Citations for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) – 4 Found |
| Ohshima, Kenji; Nojima, Satoshi; Tahara, Shinichiro; Kurashige, Masako; Hori, Yumiko; Hagiwara, Kohei; Okuzaki, Daisuke; Oki, Shinya; Wada, Naoki; Ikeda, Jun-Ichiro; Kanai, Yoshikatsu; Morii, Eiichi. Argininosuccinate Synthase 1-Deficiency Enhances the Cell Sensitivity to Arginine through Decreased DEPTOR Expression in Endometrial Cancer. Scientific Reports. 2017;7( 28358054):45504. PubMed |
| Slebos, Robbert J C; Jehmlich, Nico; Brown, Brandee; Yin, Zhirong; Chung, Christine H; Yarbrough, Wendell G; Liebler, Daniel C. Proteomic analysis of oropharyngeal carcinomas reveals novel HPV-associated biological pathways. International Journal Of Cancer. 2013;132(3):568-79. PubMed |
| Edfors, Fredrik; Danielsson, Frida; Hallström, Björn M; Käll, Lukas; Lundberg, Emma; Pontén, Fredrik; Forsström, Björn; Uhlén, Mathias. Gene-specific correlation of RNA and protein levels in human cells and tissues. Molecular Systems Biology. 2016;12(10):883. PubMed |
| Werner, Anke; Pieh, Daniel; Echchannaoui, Hakim; Rupp, Johanna; Rajalingam, Krishnaraj; Theobald, Matthias; Closs, Ellen I; Munder, Markus. Cationic Amino Acid Transporter-1-Mediated Arginine Uptake Is Essential for Chronic Lymphocytic Leukemia Cell Proliferation and Viability. Frontiers In Oncology. 9( 31824848):1268. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS |
| Gene Sequence | MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS |
| Gene ID - Mouse | ENSMUSG00000076441 |
| Gene ID - Rat | ENSRNOG00000008837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) |
| Citations for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) – 4 Found |
| Ohshima, Kenji; Nojima, Satoshi; Tahara, Shinichiro; Kurashige, Masako; Hori, Yumiko; Hagiwara, Kohei; Okuzaki, Daisuke; Oki, Shinya; Wada, Naoki; Ikeda, Jun-Ichiro; Kanai, Yoshikatsu; Morii, Eiichi. Argininosuccinate Synthase 1-Deficiency Enhances the Cell Sensitivity to Arginine through Decreased DEPTOR Expression in Endometrial Cancer. Scientific Reports. 2017;7( 28358054):45504. PubMed |
| Slebos, Robbert J C; Jehmlich, Nico; Brown, Brandee; Yin, Zhirong; Chung, Christine H; Yarbrough, Wendell G; Liebler, Daniel C. Proteomic analysis of oropharyngeal carcinomas reveals novel HPV-associated biological pathways. International Journal Of Cancer. 2013;132(3):568-79. PubMed |
| Edfors, Fredrik; Danielsson, Frida; Hallström, Björn M; Käll, Lukas; Lundberg, Emma; Pontén, Fredrik; Forsström, Björn; Uhlén, Mathias. Gene-specific correlation of RNA and protein levels in human cells and tissues. Molecular Systems Biology. 2016;12(10):883. PubMed |
| Werner, Anke; Pieh, Daniel; Echchannaoui, Hakim; Rupp, Johanna; Rajalingam, Krishnaraj; Theobald, Matthias; Closs, Ellen I; Munder, Markus. Cationic Amino Acid Transporter-1-Mediated Arginine Uptake Is Essential for Chronic Lymphocytic Leukemia Cell Proliferation and Viability. Frontiers In Oncology. 9( 31824848):1268. PubMed |