Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG |
| Gene Sequence | AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG |
| Gene ID - Mouse | ENSMUSG00000076441 |
| Gene ID - Rat | ENSRNOG00000008837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) |
| Citations for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) – 2 Found |
| Locke, Matthew; Ghazaly, Essam; Freitas, Marta O; Mitsinga, Mikaella; Lattanzio, Laura; Lo Nigro, Cristiana; Nagano, Ai; Wang, Jun; Chelala, Claude; Szlosarek, Peter; Martin, Sarah A. Inhibition of the Polyamine Synthesis Pathway Is Synthetically Lethal with Loss of Argininosuccinate Synthase 1. Cell Reports. 2016;16(6):1604-1613. PubMed |
| Ji, Jennifer X; Cochrane, Dawn R; Tessier-Cloutier, Basile; Chen, Shary Yutin; Ho, Germain; Pathak, Khyatiben V; Alcazar, Isabel N; Farnell, David; Leung, Samuel; Cheng, Angela; Chow, Christine; Colborne, Shane; Negri, Gian Luca; Kommoss, Friedrich; Karnezis, Anthony; Morin, Gregg B; McAlpine, Jessica N; Gilks, C Blake; Weissman, Bernard E; Trent, Jeffrey M; Hoang, Lynn; Pirrotte, Patrick; Wang, Yemin; Huntsman, David G. Arginine Depletion Therapy with ADI-PEG20 Limits Tumor Growth in Argininosuccinate Synthase-Deficient Ovarian Cancer, Including Small-Cell Carcinoma of the Ovary, Hypercalcemic Type. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2020;26(16):4402-4413. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG |
| Gene Sequence | AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG |
| Gene ID - Mouse | ENSMUSG00000076441 |
| Gene ID - Rat | ENSRNOG00000008837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) | |
| Datasheet | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) |
| Citations for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) – 2 Found |
| Locke, Matthew; Ghazaly, Essam; Freitas, Marta O; Mitsinga, Mikaella; Lattanzio, Laura; Lo Nigro, Cristiana; Nagano, Ai; Wang, Jun; Chelala, Claude; Szlosarek, Peter; Martin, Sarah A. Inhibition of the Polyamine Synthesis Pathway Is Synthetically Lethal with Loss of Argininosuccinate Synthase 1. Cell Reports. 2016;16(6):1604-1613. PubMed |
| Ji, Jennifer X; Cochrane, Dawn R; Tessier-Cloutier, Basile; Chen, Shary Yutin; Ho, Germain; Pathak, Khyatiben V; Alcazar, Isabel N; Farnell, David; Leung, Samuel; Cheng, Angela; Chow, Christine; Colborne, Shane; Negri, Gian Luca; Kommoss, Friedrich; Karnezis, Anthony; Morin, Gregg B; McAlpine, Jessica N; Gilks, C Blake; Weissman, Bernard E; Trent, Jeffrey M; Hoang, Lynn; Pirrotte, Patrick; Wang, Yemin; Huntsman, David G. Arginine Depletion Therapy with ADI-PEG20 Limits Tumor Growth in Argininosuccinate Synthase-Deficient Ovarian Cancer, Including Small-Cell Carcinoma of the Ovary, Hypercalcemic Type. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2020;26(16):4402-4413. PubMed |