Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
| Gene Sequence | MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
| Gene ID - Mouse | ENSMUSG00000006269 |
| Gene ID - Rat | ENSRNOG00000013573 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) | |
| Datasheet | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) | |
| Datasheet | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) |
| Citations for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) – 2 Found |
| Plasschaert, Lindsey W; Žilionis, Rapolas; Choo-Wing, Rayman; Savova, Virginia; Knehr, Judith; Roma, Guglielmo; Klein, Allon M; Jaffe, Aron B. A single-cell atlas of the airway epithelium reveals the CFTR-rich pulmonary ionocyte. Nature. 2018;560(7718):377-381. PubMed |
| Zachar, Rikke; Thiel, Steffen; Hansen, Søren; Henriksen, Maiken Lumby; Skjoedt, Mikkel-Ole; Skjodt, Karsten; Hamzaei, Zohra; Madsen, Kirsten; Lund, Lars; Hummler, Edith; Svenningsen, Per; Jensen, Boye Lagerbon. Mannan-binding lectin serine protease-2 (MASP-2) in human kidney and its relevance for proteolytic activation of the epithelial sodium channel. Scientific Reports. 2022;12(1):15955. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
| Gene Sequence | MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
| Gene ID - Mouse | ENSMUSG00000006269 |
| Gene ID - Rat | ENSRNOG00000013573 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) | |
| Datasheet | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) | |
| Datasheet | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) |
| Citations for Anti ATP6V1B1 pAb (ATL-HPA031847 w/enhanced validation) – 2 Found |
| Plasschaert, Lindsey W; Žilionis, Rapolas; Choo-Wing, Rayman; Savova, Virginia; Knehr, Judith; Roma, Guglielmo; Klein, Allon M; Jaffe, Aron B. A single-cell atlas of the airway epithelium reveals the CFTR-rich pulmonary ionocyte. Nature. 2018;560(7718):377-381. PubMed |
| Zachar, Rikke; Thiel, Steffen; Hansen, Søren; Henriksen, Maiken Lumby; Skjoedt, Mikkel-Ole; Skjodt, Karsten; Hamzaei, Zohra; Madsen, Kirsten; Lund, Lars; Hummler, Edith; Svenningsen, Per; Jensen, Boye Lagerbon. Mannan-binding lectin serine protease-2 (MASP-2) in human kidney and its relevance for proteolytic activation of the epithelial sodium channel. Scientific Reports. 2022;12(1):15955. PubMed |