Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE |
| Gene Sequence | EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE |
| Gene ID - Mouse | ENSMUSG00000031229 |
| Gene ID - Rat | ENSRNOG00000056703 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATRX pAb (ATL-HPA064684) | |
| Datasheet | Anti ATRX pAb (ATL-HPA064684) Datasheet (External Link) |
| Vendor Page | Anti ATRX pAb (ATL-HPA064684) at Atlas Antibodies |
| Documents & Links for Anti ATRX pAb (ATL-HPA064684) | |
| Datasheet | Anti ATRX pAb (ATL-HPA064684) Datasheet (External Link) |
| Vendor Page | Anti ATRX pAb (ATL-HPA064684) |
| Citations for Anti ATRX pAb (ATL-HPA064684) – 1 Found |
| de Nonneville, Alexandre; Salas, Sébastien; Bertucci, François; Sobinoff, Alexander P; Adélaïde, José; Guille, Arnaud; Finetti, Pascal; Noble, Jane R; Churikov, Dimitri; Chaffanet, Max; Lavit, Elise; Pickett, Hilda A; Bouvier, Corinne; Birnbaum, Daniel; Reddel, Roger R; Géli, Vincent. TOP3A amplification and ATRX inactivation are mutually exclusive events in pediatric osteosarcomas using ALT. Embo Molecular Medicine. 2022;14(10):e15859. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE |
| Gene Sequence | EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE |
| Gene ID - Mouse | ENSMUSG00000031229 |
| Gene ID - Rat | ENSRNOG00000056703 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATRX pAb (ATL-HPA064684) | |
| Datasheet | Anti ATRX pAb (ATL-HPA064684) Datasheet (External Link) |
| Vendor Page | Anti ATRX pAb (ATL-HPA064684) at Atlas Antibodies |
| Documents & Links for Anti ATRX pAb (ATL-HPA064684) | |
| Datasheet | Anti ATRX pAb (ATL-HPA064684) Datasheet (External Link) |
| Vendor Page | Anti ATRX pAb (ATL-HPA064684) |
| Citations for Anti ATRX pAb (ATL-HPA064684) – 1 Found |
| de Nonneville, Alexandre; Salas, Sébastien; Bertucci, François; Sobinoff, Alexander P; Adélaïde, José; Guille, Arnaud; Finetti, Pascal; Noble, Jane R; Churikov, Dimitri; Chaffanet, Max; Lavit, Elise; Pickett, Hilda A; Bouvier, Corinne; Birnbaum, Daniel; Reddel, Roger R; Géli, Vincent. TOP3A amplification and ATRX inactivation are mutually exclusive events in pediatric osteosarcomas using ALT. Embo Molecular Medicine. 2022;14(10):e15859. PubMed |