Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT |
| Gene Sequence | LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT |
| Gene ID - Mouse | ENSMUSG00000068328 |
| Gene ID - Rat | ENSRNOG00000007842 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AUP1 pAb (ATL-HPA007674) | |
| Datasheet | Anti AUP1 pAb (ATL-HPA007674) Datasheet (External Link) |
| Vendor Page | Anti AUP1 pAb (ATL-HPA007674) at Atlas Antibodies |
| Documents & Links for Anti AUP1 pAb (ATL-HPA007674) | |
| Datasheet | Anti AUP1 pAb (ATL-HPA007674) Datasheet (External Link) |
| Vendor Page | Anti AUP1 pAb (ATL-HPA007674) |
| Citations for Anti AUP1 pAb (ATL-HPA007674) – 5 Found |
| Schulz, Jasmin; Avci, Dönem; Queisser, Markus A; Gutschmidt, Aljona; Dreher, Lena-Sophie; Fenech, Emma J; Volkmar, Norbert; Hayashi, Yuki; Hoppe, Thorsten; Christianson, John C. Conserved cytoplasmic domains promote Hrd1 ubiquitin ligase complex formation for ER-associated degradation (ERAD). Journal Of Cell Science. 2017;130(19):3322-3335. PubMed |
| Stefanovic-Barrett, Sandra; Dickson, Anna S; Burr, Stephen P; Williamson, James C; Lobb, Ian T; van den Boomen, Dick Jh; Lehner, Paul J; Nathan, James A. MARCH6 and TRC8 facilitate the quality control of cytosolic and tail-anchored proteins. Embo Reports. 2018;19(5) PubMed |
| Hartman, Isamu Z; Liu, Pingsheng; Zehmer, John K; Luby-Phelps, Katherine; Jo, Youngah; Anderson, Richard G W; DeBose-Boyd, Russell A. Sterol-induced dislocation of 3-hydroxy-3-methylglutaryl coenzyme A reductase from endoplasmic reticulum membranes into the cytosol through a subcellular compartment resembling lipid droplets. The Journal Of Biological Chemistry. 2010;285(25):19288-98. PubMed |
| Sugihara, Munechika; Morito, Daisuke; Ainuki, Shiori; Hirano, Yoshinobu; Ogino, Kazutoyo; Kitamura, Akira; Hirata, Hiromi; Nagata, Kazuhiro. The AAA+ ATPase/ubiquitin ligase mysterin stabilizes cytoplasmic lipid droplets. The Journal Of Cell Biology. 2019;218(3):949-960. PubMed |
| Fenech, Emma J; Lari, Federica; Charles, Philip D; Fischer, Roman; Laétitia-Thézénas, Marie; Bagola, Katrin; Paton, Adrienne W; Paton, James C; Gyrd-Hansen, Mads; Kessler, Benedikt M; Christianson, John C. Interaction mapping of endoplasmic reticulum ubiquitin ligases identifies modulators of innate immune signalling. Elife. 2020;9( 32614325) PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT |
| Gene Sequence | LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT |
| Gene ID - Mouse | ENSMUSG00000068328 |
| Gene ID - Rat | ENSRNOG00000007842 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AUP1 pAb (ATL-HPA007674) | |
| Datasheet | Anti AUP1 pAb (ATL-HPA007674) Datasheet (External Link) |
| Vendor Page | Anti AUP1 pAb (ATL-HPA007674) at Atlas Antibodies |
| Documents & Links for Anti AUP1 pAb (ATL-HPA007674) | |
| Datasheet | Anti AUP1 pAb (ATL-HPA007674) Datasheet (External Link) |
| Vendor Page | Anti AUP1 pAb (ATL-HPA007674) |
| Citations for Anti AUP1 pAb (ATL-HPA007674) – 5 Found |
| Schulz, Jasmin; Avci, Dönem; Queisser, Markus A; Gutschmidt, Aljona; Dreher, Lena-Sophie; Fenech, Emma J; Volkmar, Norbert; Hayashi, Yuki; Hoppe, Thorsten; Christianson, John C. Conserved cytoplasmic domains promote Hrd1 ubiquitin ligase complex formation for ER-associated degradation (ERAD). Journal Of Cell Science. 2017;130(19):3322-3335. PubMed |
| Stefanovic-Barrett, Sandra; Dickson, Anna S; Burr, Stephen P; Williamson, James C; Lobb, Ian T; van den Boomen, Dick Jh; Lehner, Paul J; Nathan, James A. MARCH6 and TRC8 facilitate the quality control of cytosolic and tail-anchored proteins. Embo Reports. 2018;19(5) PubMed |
| Hartman, Isamu Z; Liu, Pingsheng; Zehmer, John K; Luby-Phelps, Katherine; Jo, Youngah; Anderson, Richard G W; DeBose-Boyd, Russell A. Sterol-induced dislocation of 3-hydroxy-3-methylglutaryl coenzyme A reductase from endoplasmic reticulum membranes into the cytosol through a subcellular compartment resembling lipid droplets. The Journal Of Biological Chemistry. 2010;285(25):19288-98. PubMed |
| Sugihara, Munechika; Morito, Daisuke; Ainuki, Shiori; Hirano, Yoshinobu; Ogino, Kazutoyo; Kitamura, Akira; Hirata, Hiromi; Nagata, Kazuhiro. The AAA+ ATPase/ubiquitin ligase mysterin stabilizes cytoplasmic lipid droplets. The Journal Of Cell Biology. 2019;218(3):949-960. PubMed |
| Fenech, Emma J; Lari, Federica; Charles, Philip D; Fischer, Roman; Laétitia-Thézénas, Marie; Bagola, Katrin; Paton, Adrienne W; Paton, James C; Gyrd-Hansen, Mads; Kessler, Benedikt M; Christianson, John C. Interaction mapping of endoplasmic reticulum ubiquitin ligases identifies modulators of innate immune signalling. Elife. 2020;9( 32614325) PubMed |