Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45158/25040/atl-hpa020863_anti-aven-pab-atl-hpa020863_35829__02021.1783628154.jpg?compression=lossy)

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45158/25040/atl-hpa020863_anti-aven-pab-atl-hpa020863_35829__02021.1783628154.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK |
| Gene Sequence | GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK |
| Gene ID - Mouse | ENSMUSG00000003604 |
| Gene ID - Rat | ENSRNOG00000006419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AVEN pAb (ATL-HPA020863) | |
| Datasheet | Anti AVEN pAb (ATL-HPA020863) Datasheet (External Link) |
| Vendor Page | Anti AVEN pAb (ATL-HPA020863) at Atlas Antibodies |
| Documents & Links for Anti AVEN pAb (ATL-HPA020863) | |
| Datasheet | Anti AVEN pAb (ATL-HPA020863) Datasheet (External Link) |
| Vendor Page | Anti AVEN pAb (ATL-HPA020863) |
| Citations for Anti AVEN pAb (ATL-HPA020863) – 1 Found |
| Muther, Charlotte; Jobeili, Lara; Garion, Maëlle; Heraud, Sandrine; Thepot, Amélie; Damour, Odile; Lamartine, Jérôme. An expression screen for aged-dependent microRNAs identifies miR-30a as a key regulator of aging features in human epidermis. Aging. 2017;9(11):2376-2396. PubMed |

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45158/25040/atl-hpa020863_anti-aven-pab-atl-hpa020863_35829__02021.1783628154.jpg?compression=lossy)

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45158/25040/atl-hpa020863_anti-aven-pab-atl-hpa020863_35829__02021.1783628154.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK |
| Gene Sequence | GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK |
| Gene ID - Mouse | ENSMUSG00000003604 |
| Gene ID - Rat | ENSRNOG00000006419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AVEN pAb (ATL-HPA020863) | |
| Datasheet | Anti AVEN pAb (ATL-HPA020863) Datasheet (External Link) |
| Vendor Page | Anti AVEN pAb (ATL-HPA020863) at Atlas Antibodies |
| Documents & Links for Anti AVEN pAb (ATL-HPA020863) | |
| Datasheet | Anti AVEN pAb (ATL-HPA020863) Datasheet (External Link) |
| Vendor Page | Anti AVEN pAb (ATL-HPA020863) |
| Citations for Anti AVEN pAb (ATL-HPA020863) – 1 Found |
| Muther, Charlotte; Jobeili, Lara; Garion, Maëlle; Heraud, Sandrine; Thepot, Amélie; Damour, Odile; Lamartine, Jérôme. An expression screen for aged-dependent microRNAs identifies miR-30a as a key regulator of aging features in human epidermis. Aging. 2017;9(11):2376-2396. PubMed |