Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ |
| Gene Sequence | PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ |
| Gene ID - Mouse | ENSMUSG00000002602 |
| Gene ID - Rat | ENSRNOG00000020716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) | |
| Datasheet | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) | |
| Datasheet | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) |
| Citations for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) – 5 Found |
| Wang, Lining; Liu, Kangkang; Yu, Jianpeng; Sun, Erlin. A retrospective analysis of the correlation between AXL expression and clinical outcomes of patients with urothelial bladder carcinoma. Translational Cancer Research. 2019;8(3):976-984. PubMed |
| Pinato, D J; Mauri, F A; Lloyd, T; Vaira, V; Casadio, C; Boldorini, R L; Sharma, R. The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma. British Journal Of Cancer. 2013;108(3):621-8. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Ong, Chee Wee; Chong, Pei Yi; McArt, Darragh G; Chan, Jason Yongsheng; Tan, Hwee Tong; Kumar, Alan Prem; Chung, Maxey C M; Clément, Marie-Véronique; Soong, Richie; Van Schaeybroeck, Sandra; Waugh, David J J; Johnston, Patrick G; Dunne, Philip D; Salto-Tellez, Manuel. The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers. Oncotarget. 2015;6(14):12763-73. PubMed |
| Pinato, David J; Brown, Matthew W; Trousil, Sebastian; Aboagye, Eric O; Beaumont, Jamie; Zhang, Hua; Coley, Helen M; Mauri, Francesco A; Sharma, Rohini. Integrated analysis of multiple receptor tyrosine kinases identifies Axl as a therapeutic target and mediator of resistance to sorafenib in hepatocellular carcinoma. British Journal Of Cancer. 2019;120(5):512-521. PubMed |




| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ |
| Gene Sequence | PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ |
| Gene ID - Mouse | ENSMUSG00000002602 |
| Gene ID - Rat | ENSRNOG00000020716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) | |
| Datasheet | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) | |
| Datasheet | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037422 w/enhanced validation) |
| Citations for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) – 5 Found |
| Wang, Lining; Liu, Kangkang; Yu, Jianpeng; Sun, Erlin. A retrospective analysis of the correlation between AXL expression and clinical outcomes of patients with urothelial bladder carcinoma. Translational Cancer Research. 2019;8(3):976-984. PubMed |
| Pinato, D J; Mauri, F A; Lloyd, T; Vaira, V; Casadio, C; Boldorini, R L; Sharma, R. The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma. British Journal Of Cancer. 2013;108(3):621-8. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Ong, Chee Wee; Chong, Pei Yi; McArt, Darragh G; Chan, Jason Yongsheng; Tan, Hwee Tong; Kumar, Alan Prem; Chung, Maxey C M; Clément, Marie-Véronique; Soong, Richie; Van Schaeybroeck, Sandra; Waugh, David J J; Johnston, Patrick G; Dunne, Philip D; Salto-Tellez, Manuel. The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers. Oncotarget. 2015;6(14):12763-73. PubMed |
| Pinato, David J; Brown, Matthew W; Trousil, Sebastian; Aboagye, Eric O; Beaumont, Jamie; Zhang, Hua; Coley, Helen M; Mauri, Francesco A; Sharma, Rohini. Integrated analysis of multiple receptor tyrosine kinases identifies Axl as a therapeutic target and mediator of resistance to sorafenib in hepatocellular carcinoma. British Journal Of Cancer. 2019;120(5):512-521. PubMed |