Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL |
| Gene Sequence | ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL |
| Gene ID - Mouse | ENSMUSG00000002602 |
| Gene ID - Rat | ENSRNOG00000020716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AXL pAb (ATL-HPA037423) | |
| Datasheet | Anti AXL pAb (ATL-HPA037423) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037423) at Atlas Antibodies |
| Documents & Links for Anti AXL pAb (ATL-HPA037423) | |
| Datasheet | Anti AXL pAb (ATL-HPA037423) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037423) |
| Citations for Anti AXL pAb (ATL-HPA037423) – 2 Found |
| Liu, Ching-Ann; Harn, Horng-Jyh; Chen, Kuan-Pin; Lee, Jui-Hao; Lin, Shinn-Zong; Chiu, Tsung-Lang. Targeting the Axl and mTOR Pathway Synergizes Immunotherapy and Chemotherapy to Butylidenephthalide in a Recurrent GBM. Journal Of Oncology. 2022( 35646111):3236058. PubMed |
| Radke, Josefine; Schumann, Elisa; Onken, Julia; Koll, Randi; Acker, Güliz; Bodnar, Bohdan; Senger, Carolin; Tierling, Sascha; Möbs, Markus; Vajkoczy, Peter; Vidal, Anna; Högler, Sandra; Kodajova, Petra; Westphal, Dana; Meier, Friedegund; Heppner, Frank; Kreuzer-Redmer, Susanne; Grebien, Florian; Jürchott, Karsten; Redmer, Torben. Decoding molecular programs in melanoma brain metastases. Nature Communications. 2022;13(1):7304. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL |
| Gene Sequence | ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL |
| Gene ID - Mouse | ENSMUSG00000002602 |
| Gene ID - Rat | ENSRNOG00000020716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AXL pAb (ATL-HPA037423) | |
| Datasheet | Anti AXL pAb (ATL-HPA037423) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037423) at Atlas Antibodies |
| Documents & Links for Anti AXL pAb (ATL-HPA037423) | |
| Datasheet | Anti AXL pAb (ATL-HPA037423) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA037423) |
| Citations for Anti AXL pAb (ATL-HPA037423) – 2 Found |
| Liu, Ching-Ann; Harn, Horng-Jyh; Chen, Kuan-Pin; Lee, Jui-Hao; Lin, Shinn-Zong; Chiu, Tsung-Lang. Targeting the Axl and mTOR Pathway Synergizes Immunotherapy and Chemotherapy to Butylidenephthalide in a Recurrent GBM. Journal Of Oncology. 2022( 35646111):3236058. PubMed |
| Radke, Josefine; Schumann, Elisa; Onken, Julia; Koll, Randi; Acker, Güliz; Bodnar, Bohdan; Senger, Carolin; Tierling, Sascha; Möbs, Markus; Vajkoczy, Peter; Vidal, Anna; Högler, Sandra; Kodajova, Petra; Westphal, Dana; Meier, Friedegund; Heppner, Frank; Kreuzer-Redmer, Susanne; Grebien, Florian; Jürchott, Karsten; Redmer, Torben. Decoding molecular programs in melanoma brain metastases. Nature Communications. 2022;13(1):7304. PubMed |