Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
| Gene Sequence | FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
| Gene ID - Mouse | ENSMUSG00000028413 |
| Gene ID - Rat | ENSRNOG00000059461 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) | |
| Datasheet | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) | |
| Datasheet | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) |
| Citations for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) – 2 Found |
| Xie, Huyang; Zhu, Yu; Zhang, Junyu; Liu, Zheng; Fu, Hangcheng; Cao, Yifan; Li, Gaoxiang; Shen, Yijun; Dai, Bo; Xu, Jiejie; Ye, Dingwei. B4GALT1 expression predicts prognosis and adjuvant chemotherapy benefits in muscle-invasive bladder cancer patients. Bmc Cancer. 2018;18(1):590. PubMed |
| Xie, Huyang; Zhu, Yu; An, Huimin; Wang, Hongkai; Zhu, Yao; Fu, Hangcheng; Wang, Zewei; Fu, Qiang; Xu, Jiejie; Ye, Dingwei. Increased B4GALT1 expression associates with adverse outcome in patients with non-metastatic clear cell renal cell carcinoma. Oncotarget. 2016;7(22):32723-30. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
| Gene Sequence | FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
| Gene ID - Mouse | ENSMUSG00000028413 |
| Gene ID - Rat | ENSRNOG00000059461 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) | |
| Datasheet | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) | |
| Datasheet | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) |
| Citations for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) – 2 Found |
| Xie, Huyang; Zhu, Yu; Zhang, Junyu; Liu, Zheng; Fu, Hangcheng; Cao, Yifan; Li, Gaoxiang; Shen, Yijun; Dai, Bo; Xu, Jiejie; Ye, Dingwei. B4GALT1 expression predicts prognosis and adjuvant chemotherapy benefits in muscle-invasive bladder cancer patients. Bmc Cancer. 2018;18(1):590. PubMed |
| Xie, Huyang; Zhu, Yu; An, Huimin; Wang, Hongkai; Zhu, Yao; Fu, Hangcheng; Wang, Zewei; Fu, Qiang; Xu, Jiejie; Ye, Dingwei. Increased B4GALT1 expression associates with adverse outcome in patients with non-metastatic clear cell renal cell carcinoma. Oncotarget. 2016;7(22):32723-30. PubMed |