Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS |
| Gene Sequence | SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS |
| Gene ID - Mouse | ENSMUSG00000024392 |
| Gene ID - Rat | ENSRNOG00000000851 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) | |
| Datasheet | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) | |
| Datasheet | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) |
| Citations for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) – 1 Found |
| Drury, Josephine A; Parkin, Kirstin L; Coyne, Lucy; Giuliani, Emma; Fazleabas, Asgerally T; Hapangama, Dharani K. The dynamic changes in the number of uterine natural killer cells are specific to the eutopic but not to the ectopic endometrium in women and in a baboon model of endometriosis. Reproductive Biology And Endocrinology : Rb&E. 2018;16(1):67. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS |
| Gene Sequence | SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS |
| Gene ID - Mouse | ENSMUSG00000024392 |
| Gene ID - Rat | ENSRNOG00000000851 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) | |
| Datasheet | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) | |
| Datasheet | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) |
| Citations for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) – 1 Found |
| Drury, Josephine A; Parkin, Kirstin L; Coyne, Lucy; Giuliani, Emma; Fazleabas, Asgerally T; Hapangama, Dharani K. The dynamic changes in the number of uterine natural killer cells are specific to the eutopic but not to the ectopic endometrium in women and in a baboon model of endometriosis. Reproductive Biology And Endocrinology : Rb&E. 2018;16(1):67. PubMed |