Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN |
| Gene Sequence | ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN |
| Gene ID - Mouse | ENSMUSG00000038859 |
| Gene ID - Rat | ENSRNOG00000001007 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) | |
| Datasheet | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) | |
| Datasheet | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) |
| Citations for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) – 1 Found |
| Chou, Ai Mei; Sem, Kai Ping; Lam, Wei Jun; Ahmed, Sohail; Lim, Chin Yan. Redundant functions of I-BAR family members, IRSp53 and IRTKS, are essential for embryonic development. Scientific Reports. 2017;7( 28067313):40485. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN |
| Gene Sequence | ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN |
| Gene ID - Mouse | ENSMUSG00000038859 |
| Gene ID - Rat | ENSRNOG00000001007 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) | |
| Datasheet | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) | |
| Datasheet | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) |
| Citations for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) – 1 Found |
| Chou, Ai Mei; Sem, Kai Ping; Lam, Wei Jun; Ahmed, Sohail; Lim, Chin Yan. Redundant functions of I-BAR family members, IRSp53 and IRTKS, are essential for embryonic development. Scientific Reports. 2017;7( 28067313):40485. PubMed |