Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: B-cell receptor-associated protein 31
Gene Name: BCAP31
Alternative Gene Name: 6C6-Ag, BAP31, CDM, DXS1357E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002015: 85%, ENSRNOG00000055756: 84%
Entrez Gene ID: 10134
Uniprot ID: P51572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human, Mouse, Rat
Clonality	Polyclonal
Host	Rabbit
Immunogen	ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Gene Sequence	ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Gene ID - Mouse	ENSMUSG00000002015
Gene ID - Rat	ENSRNOG00000055756
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)
Datasheet	Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)
Datasheet	Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)

Citations for Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) – 1 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed

No related products found

Reviews 0

Reviews

Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)

Additional information

Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)

Additional information

Specifications

No related products found

Reviews 0

Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)

Additional information

Specifications

Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)

Additional information

Specifications

Specifications