Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44405/23557/atl-hpa017995_anti-bckdk-pab-atl-hpa017995_34311__57210.1783627066.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY |
| Gene Sequence | LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY |
| Gene ID - Mouse | ENSMUSG00000030802 |
| Gene ID - Rat | ENSRNOG00000019485 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCKDK pAb (ATL-HPA017995) | |
| Datasheet | Anti BCKDK pAb (ATL-HPA017995) Datasheet (External Link) |
| Vendor Page | Anti BCKDK pAb (ATL-HPA017995) at Atlas Antibodies |
| Documents & Links for Anti BCKDK pAb (ATL-HPA017995) | |
| Datasheet | Anti BCKDK pAb (ATL-HPA017995) Datasheet (External Link) |
| Vendor Page | Anti BCKDK pAb (ATL-HPA017995) |
| Citations for Anti BCKDK pAb (ATL-HPA017995) – 1 Found |
| Neinast, Michael D; Jang, Cholsoon; Hui, Sheng; Murashige, Danielle S; Chu, Qingwei; Morscher, Raphael J; Li, Xiaoxuan; Zhan, Le; White, Eileen; Anthony, Tracy G; Rabinowitz, Joshua D; Arany, Zoltan. Quantitative Analysis of the Whole-Body Metabolic Fate of Branched-Chain Amino Acids. Cell Metabolism. 2019;29(2):417-429.e4. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY |
| Gene Sequence | LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY |
| Gene ID - Mouse | ENSMUSG00000030802 |
| Gene ID - Rat | ENSRNOG00000019485 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCKDK pAb (ATL-HPA017995) | |
| Datasheet | Anti BCKDK pAb (ATL-HPA017995) Datasheet (External Link) |
| Vendor Page | Anti BCKDK pAb (ATL-HPA017995) at Atlas Antibodies |
| Documents & Links for Anti BCKDK pAb (ATL-HPA017995) | |
| Datasheet | Anti BCKDK pAb (ATL-HPA017995) Datasheet (External Link) |
| Vendor Page | Anti BCKDK pAb (ATL-HPA017995) |
| Citations for Anti BCKDK pAb (ATL-HPA017995) – 1 Found |
| Neinast, Michael D; Jang, Cholsoon; Hui, Sheng; Murashige, Danielle S; Chu, Qingwei; Morscher, Raphael J; Li, Xiaoxuan; Zhan, Le; White, Eileen; Anthony, Tracy G; Rabinowitz, Joshua D; Arany, Zoltan. Quantitative Analysis of the Whole-Body Metabolic Fate of Branched-Chain Amino Acids. Cell Metabolism. 2019;29(2):417-429.e4. PubMed |