Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49230/32562/atl-hpa035734_anti-bcl2l1-pab-atl-hpa035734_43562__99206.1783633611.jpg?compression=lossy)

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49230/32562/atl-hpa035734_anti-bcl2l1-pab-atl-hpa035734_43562__99206.1783633611.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG |
| Gene Sequence | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG |
| Gene ID - Mouse | ENSMUSG00000007659 |
| Gene ID - Rat | ENSRNOG00000007946 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL2L1 pAb (ATL-HPA035734) | |
| Datasheet | Anti BCL2L1 pAb (ATL-HPA035734) Datasheet (External Link) |
| Vendor Page | Anti BCL2L1 pAb (ATL-HPA035734) at Atlas Antibodies |
| Documents & Links for Anti BCL2L1 pAb (ATL-HPA035734) | |
| Datasheet | Anti BCL2L1 pAb (ATL-HPA035734) Datasheet (External Link) |
| Vendor Page | Anti BCL2L1 pAb (ATL-HPA035734) |
| Citations for Anti BCL2L1 pAb (ATL-HPA035734) – 1 Found |
| Borrás, Consuelo; Mas-Bargues, Cristina; Román-Domínguez, Aurora; Sanz-Ros, Jorge; Gimeno-Mallench, Lucia; Inglés, Marta; Gambini, Juan; Viña, José. BCL-xL, a Mitochondrial Protein Involved in Successful Aging: From C. elegans to Human Centenarians. International Journal Of Molecular Sciences. 2020;21(2) PubMed |

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49230/32562/atl-hpa035734_anti-bcl2l1-pab-atl-hpa035734_43562__99206.1783633611.jpg?compression=lossy)

![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49230/32562/atl-hpa035734_anti-bcl2l1-pab-atl-hpa035734_43562__99206.1783633611.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG |
| Gene Sequence | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG |
| Gene ID - Mouse | ENSMUSG00000007659 |
| Gene ID - Rat | ENSRNOG00000007946 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL2L1 pAb (ATL-HPA035734) | |
| Datasheet | Anti BCL2L1 pAb (ATL-HPA035734) Datasheet (External Link) |
| Vendor Page | Anti BCL2L1 pAb (ATL-HPA035734) at Atlas Antibodies |
| Documents & Links for Anti BCL2L1 pAb (ATL-HPA035734) | |
| Datasheet | Anti BCL2L1 pAb (ATL-HPA035734) Datasheet (External Link) |
| Vendor Page | Anti BCL2L1 pAb (ATL-HPA035734) |
| Citations for Anti BCL2L1 pAb (ATL-HPA035734) – 1 Found |
| Borrás, Consuelo; Mas-Bargues, Cristina; Román-Domínguez, Aurora; Sanz-Ros, Jorge; Gimeno-Mallench, Lucia; Inglés, Marta; Gambini, Juan; Viña, José. BCL-xL, a Mitochondrial Protein Involved in Successful Aging: From C. elegans to Human Centenarians. International Journal Of Molecular Sciences. 2020;21(2) PubMed |