Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL |
| Gene Sequence | GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL |
| Gene ID - Mouse | ENSMUSG00000030200 |
| Gene ID - Rat | ENSRNOG00000028632 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) | |
| Datasheet | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) | |
| Datasheet | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) |
| Citations for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) – 1 Found |
| Woznicki, Jerzy A; Flood, Peter; Bustamante-Garrido, Milan; Stamou, Panagiota; Moloney, Gerry; Fanning, Aine; Zulquernain, Syed Akbar; McCarthy, Jane; Shanahan, Fergus; Melgar, Silvia; Nally, Ken. Human BCL-G regulates secretion of inflammatory chemokines but is dispensable for induction of apoptosis by IFN-γ and TNF-α in intestinal epithelial cells. Cell Death & Disease. 2020;11(1):68. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL |
| Gene Sequence | GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL |
| Gene ID - Mouse | ENSMUSG00000030200 |
| Gene ID - Rat | ENSRNOG00000028632 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) | |
| Datasheet | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) | |
| Datasheet | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) |
| Citations for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) – 1 Found |
| Woznicki, Jerzy A; Flood, Peter; Bustamante-Garrido, Milan; Stamou, Panagiota; Moloney, Gerry; Fanning, Aine; Zulquernain, Syed Akbar; McCarthy, Jane; Shanahan, Fergus; Melgar, Silvia; Nally, Ken. Human BCL-G regulates secretion of inflammatory chemokines but is dispensable for induction of apoptosis by IFN-γ and TNF-α in intestinal epithelial cells. Cell Death & Disease. 2020;11(1):68. PubMed |