Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
| Gene Sequence | YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
| Gene ID - Mouse | ENSMUSG00000003452 |
| Gene ID - Rat | ENSRNOG00000036911 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BICD1 pAb (ATL-HPA041309) | |
| Datasheet | Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link) |
| Vendor Page | Anti BICD1 pAb (ATL-HPA041309) at Atlas Antibodies |
| Documents & Links for Anti BICD1 pAb (ATL-HPA041309) | |
| Datasheet | Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link) |
| Vendor Page | Anti BICD1 pAb (ATL-HPA041309) |
| Citations for Anti BICD1 pAb (ATL-HPA041309) – 3 Found |
| Terenzio, Marco; Golding, Matthew; Russell, Matthew R G; Wicher, Krzysztof B; Rosewell, Ian; Spencer-Dene, Bradley; Ish-Horowicz, David; Schiavo, Giampietro. Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors. The Embo Journal. 2014;33(14):1582-98. PubMed |
| Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129. PubMed |
| Budzinska, Marta I; Villarroel-Campos, David; Golding, Matthew; Weston, Anne; Collinson, Lucy; Snijders, Ambrosius P; Schiavo, Giampietro. PTPN23 binds the dynein adaptor BICD1 and is required for endocytic sorting of neurotrophin receptors. Journal Of Cell Science. 2020;133(6) PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
| Gene Sequence | YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
| Gene ID - Mouse | ENSMUSG00000003452 |
| Gene ID - Rat | ENSRNOG00000036911 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BICD1 pAb (ATL-HPA041309) | |
| Datasheet | Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link) |
| Vendor Page | Anti BICD1 pAb (ATL-HPA041309) at Atlas Antibodies |
| Documents & Links for Anti BICD1 pAb (ATL-HPA041309) | |
| Datasheet | Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link) |
| Vendor Page | Anti BICD1 pAb (ATL-HPA041309) |
| Citations for Anti BICD1 pAb (ATL-HPA041309) – 3 Found |
| Terenzio, Marco; Golding, Matthew; Russell, Matthew R G; Wicher, Krzysztof B; Rosewell, Ian; Spencer-Dene, Bradley; Ish-Horowicz, David; Schiavo, Giampietro. Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors. The Embo Journal. 2014;33(14):1582-98. PubMed |
| Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129. PubMed |
| Budzinska, Marta I; Villarroel-Campos, David; Golding, Matthew; Weston, Anne; Collinson, Lucy; Snijders, Ambrosius P; Schiavo, Giampietro. PTPN23 binds the dynein adaptor BICD1 and is required for endocytic sorting of neurotrophin receptors. Journal Of Cell Science. 2020;133(6) PubMed |