Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI |
| Gene Sequence | MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI |
| Gene ID - Mouse | ENSMUSG00000037933 |
| Gene ID - Rat | ENSRNOG00000016031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) | |
| Datasheet | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) | |
| Datasheet | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) |
| Citations for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) – 4 Found |
| Will, Lena; Portegies, Sybren; van Schelt, Jasper; van Luyk, Merel; Jaarsma, Dick; Hoogenraad, Casper C. Dynein activating adaptor BICD2 controls radial migration of upper-layer cortical neurons in vivo. Acta Neuropathologica Communications. 2019;7(1):162. PubMed |
| Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129. PubMed |
| Agote-Aran, Arantxa; Schmucker, Stephane; Jerabkova, Katerina; Jmel Boyer, Inès; Berto, Alessandro; Pacini, Laura; Ronchi, Paolo; Kleiss, Charlotte; Guerard, Laurent; Schwab, Yannick; Moine, Hervé; Mandel, Jean-Louis; Jacquemont, Sebastien; Bagni, Claudia; Sumara, Izabela. Spatial control of nucleoporin condensation by fragile X-related proteins. The Embo Journal. 2020;39(20):e104467. PubMed |
| Leong, Ei Leen; Khaing, Nyein Thet; Cadot, Bruno; Hong, Wei Liang; Kozlov, Serguei; Werner, Hendrikje; Wong, Esther Sook Miin; Stewart, Colin L; Burke, Brian; Lee, Yin Loon. Nesprin-1 LINC complexes recruit microtubule cytoskeleton proteins and drive pathology in Lmna-mutant striated muscle. Human Molecular Genetics. 2023;32(2):177-191. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI |
| Gene Sequence | MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI |
| Gene ID - Mouse | ENSMUSG00000037933 |
| Gene ID - Rat | ENSRNOG00000016031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) | |
| Datasheet | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) | |
| Datasheet | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) |
| Citations for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) – 4 Found |
| Will, Lena; Portegies, Sybren; van Schelt, Jasper; van Luyk, Merel; Jaarsma, Dick; Hoogenraad, Casper C. Dynein activating adaptor BICD2 controls radial migration of upper-layer cortical neurons in vivo. Acta Neuropathologica Communications. 2019;7(1):162. PubMed |
| Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129. PubMed |
| Agote-Aran, Arantxa; Schmucker, Stephane; Jerabkova, Katerina; Jmel Boyer, Inès; Berto, Alessandro; Pacini, Laura; Ronchi, Paolo; Kleiss, Charlotte; Guerard, Laurent; Schwab, Yannick; Moine, Hervé; Mandel, Jean-Louis; Jacquemont, Sebastien; Bagni, Claudia; Sumara, Izabela. Spatial control of nucleoporin condensation by fragile X-related proteins. The Embo Journal. 2020;39(20):e104467. PubMed |
| Leong, Ei Leen; Khaing, Nyein Thet; Cadot, Bruno; Hong, Wei Liang; Kozlov, Serguei; Werner, Hendrikje; Wong, Esther Sook Miin; Stewart, Colin L; Burke, Brian; Lee, Yin Loon. Nesprin-1 LINC complexes recruit microtubule cytoskeleton proteins and drive pathology in Lmna-mutant striated muscle. Human Molecular Genetics. 2023;32(2):177-191. PubMed |
No reviews have been added for this product.