Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/42101/19247/atl-hpa005513_anti-birc2-pab-atl-hpa005513_29864__01431.1783623824.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| Gene Sequence | NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| Gene ID - Mouse | ENSMUSG00000057367 |
| Gene ID - Rat | ENSRNOG00000010602 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BIRC2 pAb (ATL-HPA005513) | |
| Datasheet | Anti BIRC2 pAb (ATL-HPA005513) Datasheet (External Link) |
| Vendor Page | Anti BIRC2 pAb (ATL-HPA005513) at Atlas Antibodies |
| Documents & Links for Anti BIRC2 pAb (ATL-HPA005513) | |
| Datasheet | Anti BIRC2 pAb (ATL-HPA005513) Datasheet (External Link) |
| Vendor Page | Anti BIRC2 pAb (ATL-HPA005513) |
| Citations for Anti BIRC2 pAb (ATL-HPA005513) – 1 Found |
| Bagnjuk, Konstantin; Kast, Verena Jasmin; Tiefenbacher, Astrid; Kaseder, Melanie; Yanase, Toshihiko; Burges, Alexander; Kunz, Lars; Mayr, Doris; Mayerhofer, Artur. Inhibitor of apoptosis proteins are potential targets for treatment of granulosa cell tumors - implications from studies in KGN. Journal Of Ovarian Research. 2019;12(1):76. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| Gene Sequence | NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| Gene ID - Mouse | ENSMUSG00000057367 |
| Gene ID - Rat | ENSRNOG00000010602 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BIRC2 pAb (ATL-HPA005513) | |
| Datasheet | Anti BIRC2 pAb (ATL-HPA005513) Datasheet (External Link) |
| Vendor Page | Anti BIRC2 pAb (ATL-HPA005513) at Atlas Antibodies |
| Documents & Links for Anti BIRC2 pAb (ATL-HPA005513) | |
| Datasheet | Anti BIRC2 pAb (ATL-HPA005513) Datasheet (External Link) |
| Vendor Page | Anti BIRC2 pAb (ATL-HPA005513) |
| Citations for Anti BIRC2 pAb (ATL-HPA005513) – 1 Found |
| Bagnjuk, Konstantin; Kast, Verena Jasmin; Tiefenbacher, Astrid; Kaseder, Melanie; Yanase, Toshihiko; Burges, Alexander; Kunz, Lars; Mayr, Doris; Mayerhofer, Artur. Inhibitor of apoptosis proteins are potential targets for treatment of granulosa cell tumors - implications from studies in KGN. Journal Of Ovarian Research. 2019;12(1):76. PubMed |