Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV |
| Gene Sequence | STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV |
| Gene ID - Mouse | ENSMUSG00000030528 |
| Gene ID - Rat | ENSRNOG00000011213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLM pAb (ATL-HPA005689) | |
| Datasheet | Anti BLM pAb (ATL-HPA005689) Datasheet (External Link) |
| Vendor Page | Anti BLM pAb (ATL-HPA005689) at Atlas Antibodies |
| Documents & Links for Anti BLM pAb (ATL-HPA005689) | |
| Datasheet | Anti BLM pAb (ATL-HPA005689) Datasheet (External Link) |
| Vendor Page | Anti BLM pAb (ATL-HPA005689) |
| Citations for Anti BLM pAb (ATL-HPA005689) – 5 Found |
| Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266) PubMed |
| Croft, Laura V; Ashton, Nicholas W; Paquet, Nicolas; Bolderson, Emma; O'Byrne, Kenneth J; Richard, Derek J. hSSB1 associates with and promotes stability of the BLM helicase. Bmc Molecular Biology. 2017;18(1):13. PubMed |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Lao, Victoria Valinluck; Welcsh, Piri; Luo, Yanxin; Carter, Kelly T; Dzieciatkowski, Slavomir; Dintzis, Suzanne; Meza, Jane; Sarvetnick, Nora E; Monnat, Raymond J Jr; Loeb, Lawrence A; Grady, William M. Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers. Translational Oncology. 2013;6(4):458-69. PubMed |
| Meena, Jitendra K; Cerutti, Aurora; Beichler, Christine; Morita, Yohei; Bruhn, Christopher; Kumar, Mukesh; Kraus, Johann M; Speicher, Michael R; Wang, Zhao-Qi; Kestler, Hans A; d'Adda di Fagagna, Fabrizio; Günes, Cagatay; Rudolph, Karl Lenhard. Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion. The Embo Journal. 2015;34(10):1371-84. PubMed |




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV |
| Gene Sequence | STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV |
| Gene ID - Mouse | ENSMUSG00000030528 |
| Gene ID - Rat | ENSRNOG00000011213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLM pAb (ATL-HPA005689) | |
| Datasheet | Anti BLM pAb (ATL-HPA005689) Datasheet (External Link) |
| Vendor Page | Anti BLM pAb (ATL-HPA005689) at Atlas Antibodies |
| Documents & Links for Anti BLM pAb (ATL-HPA005689) | |
| Datasheet | Anti BLM pAb (ATL-HPA005689) Datasheet (External Link) |
| Vendor Page | Anti BLM pAb (ATL-HPA005689) |
| Citations for Anti BLM pAb (ATL-HPA005689) – 5 Found |
| Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266) PubMed |
| Croft, Laura V; Ashton, Nicholas W; Paquet, Nicolas; Bolderson, Emma; O'Byrne, Kenneth J; Richard, Derek J. hSSB1 associates with and promotes stability of the BLM helicase. Bmc Molecular Biology. 2017;18(1):13. PubMed |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Lao, Victoria Valinluck; Welcsh, Piri; Luo, Yanxin; Carter, Kelly T; Dzieciatkowski, Slavomir; Dintzis, Suzanne; Meza, Jane; Sarvetnick, Nora E; Monnat, Raymond J Jr; Loeb, Lawrence A; Grady, William M. Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers. Translational Oncology. 2013;6(4):458-69. PubMed |
| Meena, Jitendra K; Cerutti, Aurora; Beichler, Christine; Morita, Yohei; Bruhn, Christopher; Kumar, Mukesh; Kraus, Johann M; Speicher, Michael R; Wang, Zhao-Qi; Kestler, Hans A; d'Adda di Fagagna, Fabrizio; Günes, Cagatay; Rudolph, Karl Lenhard. Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion. The Embo Journal. 2015;34(10):1371-84. PubMed |