Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
| Gene Sequence | HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
| Gene ID - Mouse | ENSMUSG00000040466 |
| Gene ID - Rat | ENSRNOG00000024410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) | |
| Datasheet | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) | |
| Datasheet | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) |
| Citations for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) – 2 Found |
| Matic, Ljubica Perisic; Jesus Iglesias, Maria; Vesterlund, Mattias; Lengquist, Mariette; Hong, Mun-Gwan; Saieed, Shanga; Sanchez-Rivera, Laura; Berg, Martin; Razuvaev, Anton; Kronqvist, Malin; Lund, Kent; Caidahl, Kenneth; Gillgren, Peter; Pontén, Fredrik; Uhlén, Mathias; Schwenk, Jochen M; Hansson, Göran K; Paulsson-Berne, Gabrielle; Fagman, Erika; Roy, Joy; Hultgren, Rebecka; Bergström, Göran; Lehtiö, Janne; Odeberg, Jacob; Hedin, Ulf. Novel Multiomics Profiling of Human Carotid Atherosclerotic Plaques and Plasma Reveals Biliverdin Reductase B as a Marker of Intraplaque Hemorrhage. Jacc. Basic To Translational Science. 2018;3(4):464-480. PubMed |
| Gao, Zhihui; Ni, Xiaojian; Zheng, Bohao; Sun, Wentao; Wan, Wenze; Liu, Han; Ni, Xiaoling; Suo, Tao; Li, Na; Liu, Houbao; Shen, Sheng. Biliverdin reductase B impairs cholangiocarcinoma cell motility by inhibiting the Notch/Snail signaling pathway. Journal Of Cancer. 13(7):2159-2170. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
| Gene Sequence | HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
| Gene ID - Mouse | ENSMUSG00000040466 |
| Gene ID - Rat | ENSRNOG00000024410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) | |
| Datasheet | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) | |
| Datasheet | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) |
| Citations for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) – 2 Found |
| Matic, Ljubica Perisic; Jesus Iglesias, Maria; Vesterlund, Mattias; Lengquist, Mariette; Hong, Mun-Gwan; Saieed, Shanga; Sanchez-Rivera, Laura; Berg, Martin; Razuvaev, Anton; Kronqvist, Malin; Lund, Kent; Caidahl, Kenneth; Gillgren, Peter; Pontén, Fredrik; Uhlén, Mathias; Schwenk, Jochen M; Hansson, Göran K; Paulsson-Berne, Gabrielle; Fagman, Erika; Roy, Joy; Hultgren, Rebecka; Bergström, Göran; Lehtiö, Janne; Odeberg, Jacob; Hedin, Ulf. Novel Multiomics Profiling of Human Carotid Atherosclerotic Plaques and Plasma Reveals Biliverdin Reductase B as a Marker of Intraplaque Hemorrhage. Jacc. Basic To Translational Science. 2018;3(4):464-480. PubMed |
| Gao, Zhihui; Ni, Xiaojian; Zheng, Bohao; Sun, Wentao; Wan, Wenze; Liu, Han; Ni, Xiaoling; Suo, Tao; Li, Na; Liu, Houbao; Shen, Sheng. Biliverdin reductase B impairs cholangiocarcinoma cell motility by inhibiting the Notch/Snail signaling pathway. Journal Of Cancer. 13(7):2159-2170. PubMed |