Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE |
| Gene Sequence | QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE |
| Gene ID - Mouse | ENSMUSG00000067336 |
| Gene ID - Rat | ENSRNOG00000022196 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BMPR2 pAb (ATL-HPA049014) | |
| Datasheet | Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link) |
| Vendor Page | Anti BMPR2 pAb (ATL-HPA049014) at Atlas Antibodies |
| Documents & Links for Anti BMPR2 pAb (ATL-HPA049014) | |
| Datasheet | Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link) |
| Vendor Page | Anti BMPR2 pAb (ATL-HPA049014) |
| Citations for Anti BMPR2 pAb (ATL-HPA049014) – 2 Found |
| O'Neill, Hannah L; Cassidy, Amy P; Harris, Olivia B; Cassidy, John W. BMP2/BMPR1A is linked to tumour progression in dedifferentiated liposarcomas. Peerj. 4( 27114889):e1957. PubMed |
| Vora, Mehul; Mondal, Arindam; Jia, Dongxuan; Gaddipati, Pranya; Akel, Moumen; Gilleran, John; Roberge, Jacques; Rongo, Christopher; Langenfeld, John. Bone morphogenetic protein signaling regulation of AMPK and PI3K in lung cancer cells and C. elegans. Cell & Bioscience. 2022;12(1):76. PubMed |


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE |
| Gene Sequence | QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE |
| Gene ID - Mouse | ENSMUSG00000067336 |
| Gene ID - Rat | ENSRNOG00000022196 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BMPR2 pAb (ATL-HPA049014) | |
| Datasheet | Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link) |
| Vendor Page | Anti BMPR2 pAb (ATL-HPA049014) at Atlas Antibodies |
| Documents & Links for Anti BMPR2 pAb (ATL-HPA049014) | |
| Datasheet | Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link) |
| Vendor Page | Anti BMPR2 pAb (ATL-HPA049014) |
| Citations for Anti BMPR2 pAb (ATL-HPA049014) – 2 Found |
| O'Neill, Hannah L; Cassidy, Amy P; Harris, Olivia B; Cassidy, John W. BMP2/BMPR1A is linked to tumour progression in dedifferentiated liposarcomas. Peerj. 4( 27114889):e1957. PubMed |
| Vora, Mehul; Mondal, Arindam; Jia, Dongxuan; Gaddipati, Pranya; Akel, Moumen; Gilleran, John; Roberge, Jacques; Rongo, Christopher; Langenfeld, John. Bone morphogenetic protein signaling regulation of AMPK and PI3K in lung cancer cells and C. elegans. Cell & Bioscience. 2022;12(1):76. PubMed |