Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Gene Sequence | PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Gene ID - Mouse | ENSMUSG00000002413 |
| Gene ID - Rat | ENSRNOG00000010957 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRAF pAb (ATL-HPA001328) | |
| Datasheet | Anti BRAF pAb (ATL-HPA001328) Datasheet (External Link) |
| Vendor Page | Anti BRAF pAb (ATL-HPA001328) at Atlas Antibodies |
| Documents & Links for Anti BRAF pAb (ATL-HPA001328) | |
| Datasheet | Anti BRAF pAb (ATL-HPA001328) Datasheet (External Link) |
| Vendor Page | Anti BRAF pAb (ATL-HPA001328) |
| Citations for Anti BRAF pAb (ATL-HPA001328) – 4 Found |
| Cao, Longxing; Wang, Zhongyong; Ma, Jiawei; Chen, Jinsheng; Zhu, Haojiang; Zhou, Xiaohua; Zhu, Qing; Dong, Jun; Lan, Qing; Huang, Qiang. Clinical characteristics and molecular pathology of skull ectopic thyroid cancer. Annals Of Translational Medicine. 2016;4(23):462. PubMed |
| Beltran-Sastre, Violeta; Benisty, Hannah; Burnier, Julia; Berger, Imre; Serrano, Luis; Kiel, Christina. Tuneable endogenous mammalian target complementation via multiplexed plasmid-based recombineering. Scientific Reports. 2015;5( 26612112):17432. PubMed |
| Kiel, Christina; Benisty, Hannah; Lloréns-Rico, Veronica; Serrano, Luis. The yin-yang of kinase activation and unfolding explains the peculiarity of Val600 in the activation segment of BRAF. Elife. 2016;5( 26744778):e12814. PubMed |
| Zheng, Limei; Yan, Xiaorong; Hu, Chengcong; Zhang, Peng; Chen, Yupeng; Zheng, Qiaoyan; Hu, Liwen; Wang, Mi; Li, Guoping; Wu, Ping; Jiang, Changzhen; Tian, Jing; Zhang, Sheng; Wang, Xingfu. Observation of Clinicopathologic Features of Pituitary Adenoma With Neuronal Differentiation. Frontiers In Endocrinology. 13( 35370935):848762. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Gene Sequence | PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
| Gene ID - Mouse | ENSMUSG00000002413 |
| Gene ID - Rat | ENSRNOG00000010957 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRAF pAb (ATL-HPA001328) | |
| Datasheet | Anti BRAF pAb (ATL-HPA001328) Datasheet (External Link) |
| Vendor Page | Anti BRAF pAb (ATL-HPA001328) at Atlas Antibodies |
| Documents & Links for Anti BRAF pAb (ATL-HPA001328) | |
| Datasheet | Anti BRAF pAb (ATL-HPA001328) Datasheet (External Link) |
| Vendor Page | Anti BRAF pAb (ATL-HPA001328) |
| Citations for Anti BRAF pAb (ATL-HPA001328) – 4 Found |
| Cao, Longxing; Wang, Zhongyong; Ma, Jiawei; Chen, Jinsheng; Zhu, Haojiang; Zhou, Xiaohua; Zhu, Qing; Dong, Jun; Lan, Qing; Huang, Qiang. Clinical characteristics and molecular pathology of skull ectopic thyroid cancer. Annals Of Translational Medicine. 2016;4(23):462. PubMed |
| Beltran-Sastre, Violeta; Benisty, Hannah; Burnier, Julia; Berger, Imre; Serrano, Luis; Kiel, Christina. Tuneable endogenous mammalian target complementation via multiplexed plasmid-based recombineering. Scientific Reports. 2015;5( 26612112):17432. PubMed |
| Kiel, Christina; Benisty, Hannah; Lloréns-Rico, Veronica; Serrano, Luis. The yin-yang of kinase activation and unfolding explains the peculiarity of Val600 in the activation segment of BRAF. Elife. 2016;5( 26744778):e12814. PubMed |
| Zheng, Limei; Yan, Xiaorong; Hu, Chengcong; Zhang, Peng; Chen, Yupeng; Zheng, Qiaoyan; Hu, Liwen; Wang, Mi; Li, Guoping; Wu, Ping; Jiang, Changzhen; Tian, Jing; Zhang, Sheng; Wang, Xingfu. Observation of Clinicopathologic Features of Pituitary Adenoma With Neuronal Differentiation. Frontiers In Endocrinology. 13( 35370935):848762. PubMed |
No reviews have been added for this product.