Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS |
| Gene Sequence | VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS |
| Gene ID - Mouse | ENSMUSG00000041147 |
| Gene ID - Rat | ENSRNOG00000001111 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRCA2 pAb (ATL-HPA026815) | |
| Datasheet | Anti BRCA2 pAb (ATL-HPA026815) Datasheet (External Link) |
| Vendor Page | Anti BRCA2 pAb (ATL-HPA026815) at Atlas Antibodies |
| Documents & Links for Anti BRCA2 pAb (ATL-HPA026815) | |
| Datasheet | Anti BRCA2 pAb (ATL-HPA026815) Datasheet (External Link) |
| Vendor Page | Anti BRCA2 pAb (ATL-HPA026815) |
| Citations for Anti BRCA2 pAb (ATL-HPA026815) – 2 Found |
| Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266) PubMed |
| Vermeer, Daniel W; Coppock, Joseph D; Zeng, Erliang; Lee, Kimberly M; Spanos, William C; Onken, Michael D; Uppaluri, Ravindra; Lee, John H; Vermeer, Paola D. Metastatic model of HPV+ oropharyngeal squamous cell carcinoma demonstrates heterogeneity in tumor metastasis. Oncotarget. 2016;7(17):24194-207. PubMed |
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS |
| Gene Sequence | VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS |
| Gene ID - Mouse | ENSMUSG00000041147 |
| Gene ID - Rat | ENSRNOG00000001111 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRCA2 pAb (ATL-HPA026815) | |
| Datasheet | Anti BRCA2 pAb (ATL-HPA026815) Datasheet (External Link) |
| Vendor Page | Anti BRCA2 pAb (ATL-HPA026815) at Atlas Antibodies |
| Documents & Links for Anti BRCA2 pAb (ATL-HPA026815) | |
| Datasheet | Anti BRCA2 pAb (ATL-HPA026815) Datasheet (External Link) |
| Vendor Page | Anti BRCA2 pAb (ATL-HPA026815) |
| Citations for Anti BRCA2 pAb (ATL-HPA026815) – 2 Found |
| Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266) PubMed |
| Vermeer, Daniel W; Coppock, Joseph D; Zeng, Erliang; Lee, Kimberly M; Spanos, William C; Onken, Michael D; Uppaluri, Ravindra; Lee, John H; Vermeer, Paola D. Metastatic model of HPV+ oropharyngeal squamous cell carcinoma demonstrates heterogeneity in tumor metastasis. Oncotarget. 2016;7(17):24194-207. PubMed |