Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
| Gene Sequence | SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
| Gene ID - Mouse | ENSMUSG00000024335 |
| Gene ID - Rat | ENSRNOG00000000461 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) | |
| Datasheet | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) | |
| Datasheet | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) |
| Citations for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) – 2 Found |
| Lambert, Jean-Philippe; Picaud, Sarah; Fujisawa, Takao; Hou, Huayun; Savitsky, Pavel; Uusküla-Reimand, Liis; Gupta, Gagan D; Abdouni, Hala; Lin, Zhen-Yuan; Tucholska, Monika; Knight, James D R; Gonzalez-Badillo, Beatriz; St-Denis, Nicole; Newman, Joseph A; Stucki, Manuel; Pelletier, Laurence; Bandeira, Nuno; Wilson, Michael D; Filippakopoulos, Panagis; Gingras, Anne-Claude. Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains. Molecular Cell. 2019;73(3):621-638.e17. PubMed |
| Jostes, Sina; Nettersheim, Daniel; Fellermeyer, Martin; Schneider, Simon; Hafezi, François; Honecker, Friedemann; Schumacher, Valerie; Geyer, Matthias; Kristiansen, Glen; Schorle, Hubert. The bromodomain inhibitor JQ1 triggers growth arrest and apoptosis in testicular germ cell tumours in vitro and in vivo. Journal Of Cellular And Molecular Medicine. 2017;21(7):1300-1314. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
| Gene Sequence | SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
| Gene ID - Mouse | ENSMUSG00000024335 |
| Gene ID - Rat | ENSRNOG00000000461 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) | |
| Datasheet | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) | |
| Datasheet | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) |
| Citations for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) – 2 Found |
| Lambert, Jean-Philippe; Picaud, Sarah; Fujisawa, Takao; Hou, Huayun; Savitsky, Pavel; Uusküla-Reimand, Liis; Gupta, Gagan D; Abdouni, Hala; Lin, Zhen-Yuan; Tucholska, Monika; Knight, James D R; Gonzalez-Badillo, Beatriz; St-Denis, Nicole; Newman, Joseph A; Stucki, Manuel; Pelletier, Laurence; Bandeira, Nuno; Wilson, Michael D; Filippakopoulos, Panagis; Gingras, Anne-Claude. Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains. Molecular Cell. 2019;73(3):621-638.e17. PubMed |
| Jostes, Sina; Nettersheim, Daniel; Fellermeyer, Martin; Schneider, Simon; Hafezi, François; Honecker, Friedemann; Schumacher, Valerie; Geyer, Matthias; Kristiansen, Glen; Schorle, Hubert. The bromodomain inhibitor JQ1 triggers growth arrest and apoptosis in testicular germ cell tumours in vitro and in vivo. Journal Of Cellular And Molecular Medicine. 2017;21(7):1300-1314. PubMed |