Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
| Gene Sequence | PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
| Gene ID - Mouse | ENSMUSG00000024002 |
| Gene ID - Rat | ENSRNOG00000006770 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRD4 pAb (ATL-HPA015055) | |
| Datasheet | Anti BRD4 pAb (ATL-HPA015055) Datasheet (External Link) |
| Vendor Page | Anti BRD4 pAb (ATL-HPA015055) at Atlas Antibodies |
| Documents & Links for Anti BRD4 pAb (ATL-HPA015055) | |
| Datasheet | Anti BRD4 pAb (ATL-HPA015055) Datasheet (External Link) |
| Vendor Page | Anti BRD4 pAb (ATL-HPA015055) |
| Citations for Anti BRD4 pAb (ATL-HPA015055) – 7 Found |
| Li, Gong-Quan; Guo, Wen-Zhi; Zhang, Yi; Seng, Jing-Jing; Zhang, Hua-Peng; Ma, Xiu-Xian; Zhang, Gong; Li, Jie; Yan, Bing; Tang, Hong-Wei; Li, Shan-Shan; Wang, Li-Dong; Zhang, Shui-Jun. Suppression of BRD4 inhibits human hepatocellular carcinoma by repressing MYC and enhancing BIM expression. Oncotarget. 2016;7(3):2462-74. PubMed |
| Shah, Neel; Wang, Ping; Wongvipat, John; Karthaus, Wouter R; Abida, Wassim; Armenia, Joshua; Rockowitz, Shira; Drier, Yotam; Bernstein, Bradley E; Long, Henry W; Freedman, Matthew L; Arora, Vivek K; Zheng, Deyou; Sawyers, Charles L. Regulation of the glucocorticoid receptor via a BET-dependent enhancer drives antiandrogen resistance in prostate cancer. Elife. 2017;6( 28891793) PubMed |
| Zuber, Johannes; Shi, Junwei; Wang, Eric; Rappaport, Amy R; Herrmann, Harald; Sison, Edward A; Magoon, Daniel; Qi, Jun; Blatt, Katharina; Wunderlich, Mark; Taylor, Meredith J; Johns, Christopher; Chicas, Agustin; Mulloy, James C; Kogan, Scott C; Brown, Patrick; Valent, Peter; Bradner, James E; Lowe, Scott W; Vakoc, Christopher R. RNAi screen identifies Brd4 as a therapeutic target in acute myeloid leukaemia. Nature. 2011;478(7370):524-8. PubMed |
| Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614. PubMed |
| Lu, Rui; Wang, Jun; Ren, Zhihong; Yin, Jiekai; Wang, Yinsheng; Cai, Ling; Wang, Gang Greg. A Model System for Studying the DNMT3A Hotspot Mutation (DNMT3A(R882)) Demonstrates a Causal Relationship between Its Dominant-Negative Effect and Leukemogenesis. Cancer Research. 2019;79(14):3583-3594. PubMed |
| Määttä, Tomi A; Rettel, Mandy; Sridharan, Sindhuja; Helm, Dominic; Kurzawa, Nils; Stein, Frank; Savitski, Mikhail M. Aggregation and disaggregation features of the human proteome. Molecular Systems Biology. 2020;16(10):e9500. PubMed |
| Alonso-Curbelo, Direna; Ho, Yu-Jui; Burdziak, Cassandra; Maag, Jesper L V; Morris, John P 4th; Chandwani, Rohit; Chen, Hsuan-An; Tsanov, Kaloyan M; Barriga, Francisco M; Luan, Wei; Tasdemir, Nilgun; Livshits, Geulah; Azizi, Elham; Chun, Jaeyoung; Wilkinson, John E; Mazutis, Linas; Leach, Steven D; Koche, Richard; Pe'er, Dana; Lowe, Scott W. A gene-environment-induced epigenetic program initiates tumorigenesis. Nature. 2021;590(7847):642-648. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
| Gene Sequence | PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
| Gene ID - Mouse | ENSMUSG00000024002 |
| Gene ID - Rat | ENSRNOG00000006770 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRD4 pAb (ATL-HPA015055) | |
| Datasheet | Anti BRD4 pAb (ATL-HPA015055) Datasheet (External Link) |
| Vendor Page | Anti BRD4 pAb (ATL-HPA015055) at Atlas Antibodies |
| Documents & Links for Anti BRD4 pAb (ATL-HPA015055) | |
| Datasheet | Anti BRD4 pAb (ATL-HPA015055) Datasheet (External Link) |
| Vendor Page | Anti BRD4 pAb (ATL-HPA015055) |
| Citations for Anti BRD4 pAb (ATL-HPA015055) – 7 Found |
| Li, Gong-Quan; Guo, Wen-Zhi; Zhang, Yi; Seng, Jing-Jing; Zhang, Hua-Peng; Ma, Xiu-Xian; Zhang, Gong; Li, Jie; Yan, Bing; Tang, Hong-Wei; Li, Shan-Shan; Wang, Li-Dong; Zhang, Shui-Jun. Suppression of BRD4 inhibits human hepatocellular carcinoma by repressing MYC and enhancing BIM expression. Oncotarget. 2016;7(3):2462-74. PubMed |
| Shah, Neel; Wang, Ping; Wongvipat, John; Karthaus, Wouter R; Abida, Wassim; Armenia, Joshua; Rockowitz, Shira; Drier, Yotam; Bernstein, Bradley E; Long, Henry W; Freedman, Matthew L; Arora, Vivek K; Zheng, Deyou; Sawyers, Charles L. Regulation of the glucocorticoid receptor via a BET-dependent enhancer drives antiandrogen resistance in prostate cancer. Elife. 2017;6( 28891793) PubMed |
| Zuber, Johannes; Shi, Junwei; Wang, Eric; Rappaport, Amy R; Herrmann, Harald; Sison, Edward A; Magoon, Daniel; Qi, Jun; Blatt, Katharina; Wunderlich, Mark; Taylor, Meredith J; Johns, Christopher; Chicas, Agustin; Mulloy, James C; Kogan, Scott C; Brown, Patrick; Valent, Peter; Bradner, James E; Lowe, Scott W; Vakoc, Christopher R. RNAi screen identifies Brd4 as a therapeutic target in acute myeloid leukaemia. Nature. 2011;478(7370):524-8. PubMed |
| Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614. PubMed |
| Lu, Rui; Wang, Jun; Ren, Zhihong; Yin, Jiekai; Wang, Yinsheng; Cai, Ling; Wang, Gang Greg. A Model System for Studying the DNMT3A Hotspot Mutation (DNMT3A(R882)) Demonstrates a Causal Relationship between Its Dominant-Negative Effect and Leukemogenesis. Cancer Research. 2019;79(14):3583-3594. PubMed |
| Määttä, Tomi A; Rettel, Mandy; Sridharan, Sindhuja; Helm, Dominic; Kurzawa, Nils; Stein, Frank; Savitski, Mikhail M. Aggregation and disaggregation features of the human proteome. Molecular Systems Biology. 2020;16(10):e9500. PubMed |
| Alonso-Curbelo, Direna; Ho, Yu-Jui; Burdziak, Cassandra; Maag, Jesper L V; Morris, John P 4th; Chandwani, Rohit; Chen, Hsuan-An; Tsanov, Kaloyan M; Barriga, Francisco M; Luan, Wei; Tasdemir, Nilgun; Livshits, Geulah; Azizi, Elham; Chun, Jaeyoung; Wilkinson, John E; Mazutis, Linas; Leach, Steven D; Koche, Richard; Pe'er, Dana; Lowe, Scott W. A gene-environment-induced epigenetic program initiates tumorigenesis. Nature. 2021;590(7847):642-648. PubMed |