Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW |
| Gene Sequence | PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW |
| Gene ID - Mouse | ENSMUSG00000004031 |
| Gene ID - Rat | ENSRNOG00000005592 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRINP2 pAb (ATL-HPA061920) | |
| Datasheet | Anti BRINP2 pAb (ATL-HPA061920) Datasheet (External Link) |
| Vendor Page | Anti BRINP2 pAb (ATL-HPA061920) at Atlas Antibodies |
| Documents & Links for Anti BRINP2 pAb (ATL-HPA061920) | |
| Datasheet | Anti BRINP2 pAb (ATL-HPA061920) Datasheet (External Link) |
| Vendor Page | Anti BRINP2 pAb (ATL-HPA061920) |
| Citations for Anti BRINP2 pAb (ATL-HPA061920) – 1 Found |
| Apóstolo, Nuno; Smukowski, Samuel N; Vanderlinden, Jeroen; Condomitti, Giuseppe; Rybakin, Vasily; Ten Bos, Jolijn; Trobiani, Laura; Portegies, Sybren; Vennekens, Kristel M; Gounko, Natalia V; Comoletti, Davide; Wierda, Keimpe D; Savas, Jeffrey N; de Wit, Joris. Synapse type-specific proteomic dissection identifies IgSF8 as a hippocampal CA3 microcircuit organizer. Nature Communications. 2020;11(1):5171. PubMed |


| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW |
| Gene Sequence | PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW |
| Gene ID - Mouse | ENSMUSG00000004031 |
| Gene ID - Rat | ENSRNOG00000005592 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRINP2 pAb (ATL-HPA061920) | |
| Datasheet | Anti BRINP2 pAb (ATL-HPA061920) Datasheet (External Link) |
| Vendor Page | Anti BRINP2 pAb (ATL-HPA061920) at Atlas Antibodies |
| Documents & Links for Anti BRINP2 pAb (ATL-HPA061920) | |
| Datasheet | Anti BRINP2 pAb (ATL-HPA061920) Datasheet (External Link) |
| Vendor Page | Anti BRINP2 pAb (ATL-HPA061920) |
| Citations for Anti BRINP2 pAb (ATL-HPA061920) – 1 Found |
| Apóstolo, Nuno; Smukowski, Samuel N; Vanderlinden, Jeroen; Condomitti, Giuseppe; Rybakin, Vasily; Ten Bos, Jolijn; Trobiani, Laura; Portegies, Sybren; Vennekens, Kristel M; Gounko, Natalia V; Comoletti, Davide; Wierda, Keimpe D; Savas, Jeffrey N; de Wit, Joris. Synapse type-specific proteomic dissection identifies IgSF8 as a hippocampal CA3 microcircuit organizer. Nature Communications. 2020;11(1):5171. PubMed |