Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| Gene Sequence | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| Gene ID - Mouse | ENSMUSG00000044645 |
| Gene ID - Rat | ENSRNOG00000001555 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) | |
| Datasheet | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) | |
| Datasheet | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) |
| Citations for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) – 1 Found |
| Deng, Boya; Zhao, Yang; Gou, Wenfeng; Chen, Shuo; Mao, Xiaoyun; Takano, Yasuo; Zheng, Huachuan. Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma. Tumour Biology : The Journal Of The International Society For Oncodevelopmental Biology And Medicine. 2013;34(5):2617-24. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| Gene Sequence | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| Gene ID - Mouse | ENSMUSG00000044645 |
| Gene ID - Rat | ENSRNOG00000001555 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) | |
| Datasheet | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) | |
| Datasheet | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) |
| Citations for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) – 1 Found |
| Deng, Boya; Zhao, Yang; Gou, Wenfeng; Chen, Shuo; Mao, Xiaoyun; Takano, Yasuo; Zheng, Huachuan. Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma. Tumour Biology : The Journal Of The International Society For Oncodevelopmental Biology And Medicine. 2013;34(5):2617-24. PubMed |