Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD |
| Gene Sequence | ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD |
| Gene ID - Mouse | ENSMUSG00000053216 |
| Gene ID - Rat | ENSRNOG00000003185 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTN2A1 pAb (ATL-HPA019208) | |
| Datasheet | Anti BTN2A1 pAb (ATL-HPA019208) Datasheet (External Link) |
| Vendor Page | Anti BTN2A1 pAb (ATL-HPA019208) at Atlas Antibodies |
| Documents & Links for Anti BTN2A1 pAb (ATL-HPA019208) | |
| Datasheet | Anti BTN2A1 pAb (ATL-HPA019208) Datasheet (External Link) |
| Vendor Page | Anti BTN2A1 pAb (ATL-HPA019208) |
| Citations for Anti BTN2A1 pAb (ATL-HPA019208) – 1 Found |
| Karunakaran, Mohindar M; Willcox, Carrie R; Salim, Mahboob; Paletta, Daniel; Fichtner, Alina S; Noll, Angela; Starick, Lisa; Nöhren, Anna; Begley, Charlotte R; Berwick, Katie A; Chaleil, Raphaël A G; Pitard, Vincent; Déchanet-Merville, Julie; Bates, Paul A; Kimmel, Brigitte; Knowles, Timothy J; Kunzmann, Volker; Walter, Lutz; Jeeves, Mark; Mohammed, Fiyaz; Willcox, Benjamin E; Herrmann, Thomas. Butyrophilin-2A1 Directly Binds Germline-Encoded Regions of the Vγ9Vδ2 TCR and Is Essential for Phosphoantigen Sensing. Immunity. 2020;52(3):487-498.e6. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD |
| Gene Sequence | ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD |
| Gene ID - Mouse | ENSMUSG00000053216 |
| Gene ID - Rat | ENSRNOG00000003185 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTN2A1 pAb (ATL-HPA019208) | |
| Datasheet | Anti BTN2A1 pAb (ATL-HPA019208) Datasheet (External Link) |
| Vendor Page | Anti BTN2A1 pAb (ATL-HPA019208) at Atlas Antibodies |
| Documents & Links for Anti BTN2A1 pAb (ATL-HPA019208) | |
| Datasheet | Anti BTN2A1 pAb (ATL-HPA019208) Datasheet (External Link) |
| Vendor Page | Anti BTN2A1 pAb (ATL-HPA019208) |
| Citations for Anti BTN2A1 pAb (ATL-HPA019208) – 1 Found |
| Karunakaran, Mohindar M; Willcox, Carrie R; Salim, Mahboob; Paletta, Daniel; Fichtner, Alina S; Noll, Angela; Starick, Lisa; Nöhren, Anna; Begley, Charlotte R; Berwick, Katie A; Chaleil, Raphaël A G; Pitard, Vincent; Déchanet-Merville, Julie; Bates, Paul A; Kimmel, Brigitte; Knowles, Timothy J; Kunzmann, Volker; Walter, Lutz; Jeeves, Mark; Mohammed, Fiyaz; Willcox, Benjamin E; Herrmann, Thomas. Butyrophilin-2A1 Directly Binds Germline-Encoded Regions of the Vγ9Vδ2 TCR and Is Essential for Phosphoantigen Sensing. Immunity. 2020;52(3):487-498.e6. PubMed |