Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD |
| Gene Sequence | AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD |
| Gene ID - Mouse | ENSMUSG00000030994 |
| Gene ID - Rat | ENSRNOG00000027542 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C10orf90 pAb (ATL-HPA038648) | |
| Datasheet | Anti C10orf90 pAb (ATL-HPA038648) Datasheet (External Link) |
| Vendor Page | Anti C10orf90 pAb (ATL-HPA038648) at Atlas Antibodies |
| Documents & Links for Anti C10orf90 pAb (ATL-HPA038648) | |
| Datasheet | Anti C10orf90 pAb (ATL-HPA038648) Datasheet (External Link) |
| Vendor Page | Anti C10orf90 pAb (ATL-HPA038648) |
| Citations for Anti C10orf90 pAb (ATL-HPA038648) – 1 Found |
| Kenawy, Nihal; Kalirai, Helen; Sacco, Joseph J; Lake, Sarah L; Heegaard, Steffen; Larsen, Ann-Cathrine; Finger, Paul T; Milman, Tatyana; Chin, Kimberly; Mosci, Carlo; Lanza, Francesco; Moulin, Alexandre; Schmitt, Caroline A; Caujolle, Jean Pierre; Maschi, Célia; Marinkovic, Marina; Taktak, Azzam F; Heimann, Heinrich; Damato, Bertil E; Coupland, Sarah E. Conjunctival melanoma copy number alterations and correlation with mutation status, tumor features, and clinical outcome. Pigment Cell & Melanoma Research. 2019;32(4):564-575. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD |
| Gene Sequence | AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD |
| Gene ID - Mouse | ENSMUSG00000030994 |
| Gene ID - Rat | ENSRNOG00000027542 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C10orf90 pAb (ATL-HPA038648) | |
| Datasheet | Anti C10orf90 pAb (ATL-HPA038648) Datasheet (External Link) |
| Vendor Page | Anti C10orf90 pAb (ATL-HPA038648) at Atlas Antibodies |
| Documents & Links for Anti C10orf90 pAb (ATL-HPA038648) | |
| Datasheet | Anti C10orf90 pAb (ATL-HPA038648) Datasheet (External Link) |
| Vendor Page | Anti C10orf90 pAb (ATL-HPA038648) |
| Citations for Anti C10orf90 pAb (ATL-HPA038648) – 1 Found |
| Kenawy, Nihal; Kalirai, Helen; Sacco, Joseph J; Lake, Sarah L; Heegaard, Steffen; Larsen, Ann-Cathrine; Finger, Paul T; Milman, Tatyana; Chin, Kimberly; Mosci, Carlo; Lanza, Francesco; Moulin, Alexandre; Schmitt, Caroline A; Caujolle, Jean Pierre; Maschi, Célia; Marinkovic, Marina; Taktak, Azzam F; Heimann, Heinrich; Damato, Bertil E; Coupland, Sarah E. Conjunctival melanoma copy number alterations and correlation with mutation status, tumor features, and clinical outcome. Pigment Cell & Melanoma Research. 2019;32(4):564-575. PubMed |
No reviews have been added for this product.