Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51363/36424/atl-hpa040511_anti-c11orf54-pab-atl-hpa040511_47536__79649.1783636334.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51363/36424/atl-hpa040511_anti-c11orf54-pab-atl-hpa040511_47536__79649.1783636334.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN |
| Gene Sequence | TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN |
| Gene ID - Mouse | ENSMUSG00000031938 |
| Gene ID - Rat | ENSRNOG00000010887 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C11orf54 pAb (ATL-HPA040511) | |
| Datasheet | Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link) |
| Vendor Page | Anti C11orf54 pAb (ATL-HPA040511) at Atlas Antibodies |
| Documents & Links for Anti C11orf54 pAb (ATL-HPA040511) | |
| Datasheet | Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link) |
| Vendor Page | Anti C11orf54 pAb (ATL-HPA040511) |
| Citations for Anti C11orf54 pAb (ATL-HPA040511) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51363/36424/atl-hpa040511_anti-c11orf54-pab-atl-hpa040511_47536__79649.1783636334.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/51363/36424/atl-hpa040511_anti-c11orf54-pab-atl-hpa040511_47536__79649.1783636334.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN |
| Gene Sequence | TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN |
| Gene ID - Mouse | ENSMUSG00000031938 |
| Gene ID - Rat | ENSRNOG00000010887 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C11orf54 pAb (ATL-HPA040511) | |
| Datasheet | Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link) |
| Vendor Page | Anti C11orf54 pAb (ATL-HPA040511) at Atlas Antibodies |
| Documents & Links for Anti C11orf54 pAb (ATL-HPA040511) | |
| Datasheet | Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link) |
| Vendor Page | Anti C11orf54 pAb (ATL-HPA040511) |
| Citations for Anti C11orf54 pAb (ATL-HPA040511) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |