Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Mouse Cerebral Cortex tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41893/18831/atl-hpa004061_anti-c17orf75-pab-atl-hpa004061_29438__29766.1783623512.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI |
| Gene Sequence | PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI |
| Gene ID - Mouse | ENSMUSG00000057181 |
| Gene ID - Rat | ENSRNOG00000000237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C17orf75 pAb (ATL-HPA004061) | |
| Datasheet | Anti C17orf75 pAb (ATL-HPA004061) Datasheet (External Link) |
| Vendor Page | Anti C17orf75 pAb (ATL-HPA004061) at Atlas Antibodies |
| Documents & Links for Anti C17orf75 pAb (ATL-HPA004061) | |
| Datasheet | Anti C17orf75 pAb (ATL-HPA004061) Datasheet (External Link) |
| Vendor Page | Anti C17orf75 pAb (ATL-HPA004061) |
| Citations for Anti C17orf75 pAb (ATL-HPA004061) – 1 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI |
| Gene Sequence | PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI |
| Gene ID - Mouse | ENSMUSG00000057181 |
| Gene ID - Rat | ENSRNOG00000000237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C17orf75 pAb (ATL-HPA004061) | |
| Datasheet | Anti C17orf75 pAb (ATL-HPA004061) Datasheet (External Link) |
| Vendor Page | Anti C17orf75 pAb (ATL-HPA004061) at Atlas Antibodies |
| Documents & Links for Anti C17orf75 pAb (ATL-HPA004061) | |
| Datasheet | Anti C17orf75 pAb (ATL-HPA004061) Datasheet (External Link) |
| Vendor Page | Anti C17orf75 pAb (ATL-HPA004061) |
| Citations for Anti C17orf75 pAb (ATL-HPA004061) – 1 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |