Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
| Gene Sequence | SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
| Gene ID - Mouse | ENSMUSG00000053783 |
| Gene ID - Rat | ENSRNOG00000025287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C17orf97 pAb (ATL-HPA023583) | |
| Datasheet | Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link) |
| Vendor Page | Anti C17orf97 pAb (ATL-HPA023583) at Atlas Antibodies |
| Documents & Links for Anti C17orf97 pAb (ATL-HPA023583) | |
| Datasheet | Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link) |
| Vendor Page | Anti C17orf97 pAb (ATL-HPA023583) |
| Citations for Anti C17orf97 pAb (ATL-HPA023583) – 1 Found |
| Brower, Christopher S; Rosen, Connor E; Jones, Richard H; Wadas, Brandon C; Piatkov, Konstantin I; Varshavsky, Alexander. Liat1, an arginyltransferase-binding protein whose evolution among primates involved changes in the numbers of its 10-residue repeats. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(46):E4936-45. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
| Gene Sequence | SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
| Gene ID - Mouse | ENSMUSG00000053783 |
| Gene ID - Rat | ENSRNOG00000025287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C17orf97 pAb (ATL-HPA023583) | |
| Datasheet | Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link) |
| Vendor Page | Anti C17orf97 pAb (ATL-HPA023583) at Atlas Antibodies |
| Documents & Links for Anti C17orf97 pAb (ATL-HPA023583) | |
| Datasheet | Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link) |
| Vendor Page | Anti C17orf97 pAb (ATL-HPA023583) |
| Citations for Anti C17orf97 pAb (ATL-HPA023583) – 1 Found |
| Brower, Christopher S; Rosen, Connor E; Jones, Richard H; Wadas, Brandon C; Piatkov, Konstantin I; Varshavsky, Alexander. Liat1, an arginyltransferase-binding protein whose evolution among primates involved changes in the numbers of its 10-residue repeats. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(46):E4936-45. PubMed |