Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD |
| Gene Sequence | KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD |
| Gene ID - Mouse | ENSMUSG00000026051 |
| Gene ID - Rat | ENSRNOG00000023576 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) | |
| Datasheet | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) | |
| Datasheet | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) |
| Citations for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) – 5 Found |
| Lee, Jisook; Dang, Xitong; Borboa, Alexandra; Coimbra, Raul; Baird, Andrew; Eliceiri, Brian P. Thrombin-processed Ecrg4 recruits myeloid cells and induces antitumorigenic inflammation. Neuro-Oncology. 2015;17(5):685-96. PubMed |
| Baird, Andrew; Coimbra, Raul; Dang, Xitong; Lopez, Nicole; Lee, Jisook; Krzyzaniak, Michael; Winfield, Robert; Potenza, Bruce; Eliceiri, Brian P. Cell surface localization and release of the candidate tumor suppressor Ecrg4 from polymorphonuclear cells and monocytes activate macrophages. Journal Of Leukocyte Biology. 2012;91(5):773-81. PubMed |
| Porzionato, A; Rucinski, M; Macchi, V; Sarasin, G; Malendowicz, L K; De Caro, R. ECRG4 expression in normal rat tissues: expression study and literature review. European Journal Of Histochemistry : Ejh. 2015;59(2):2458. PubMed |
| Podvin, Sonia; Miller, Miles C; Rossi, Ryan; Chukwueke, Jasmine; Donahue, John E; Johanson, Conrad E; Baird, Andrew; Stopa, Edward G. The Orphan C2orf40 Gene is a Neuroimmune Factor in Alzheimer's Disease. Jsm Alzheimer's Disease And Related Dementia. 3(1) PubMed |
| Cabuzu, Daniela; Ramakrishnan, Suresh K; Moor, Matthias B; Harmacek, Dusan; Auberson, Muriel; Durussel, Fanny; Bonny, Olivier. Loss of Ecrg4 improves calcium oxalate nephropathy. Plos One. 17(10):e0275972. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD |
| Gene Sequence | KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD |
| Gene ID - Mouse | ENSMUSG00000026051 |
| Gene ID - Rat | ENSRNOG00000023576 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) | |
| Datasheet | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) | |
| Datasheet | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) |
| Citations for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) – 5 Found |
| Lee, Jisook; Dang, Xitong; Borboa, Alexandra; Coimbra, Raul; Baird, Andrew; Eliceiri, Brian P. Thrombin-processed Ecrg4 recruits myeloid cells and induces antitumorigenic inflammation. Neuro-Oncology. 2015;17(5):685-96. PubMed |
| Baird, Andrew; Coimbra, Raul; Dang, Xitong; Lopez, Nicole; Lee, Jisook; Krzyzaniak, Michael; Winfield, Robert; Potenza, Bruce; Eliceiri, Brian P. Cell surface localization and release of the candidate tumor suppressor Ecrg4 from polymorphonuclear cells and monocytes activate macrophages. Journal Of Leukocyte Biology. 2012;91(5):773-81. PubMed |
| Porzionato, A; Rucinski, M; Macchi, V; Sarasin, G; Malendowicz, L K; De Caro, R. ECRG4 expression in normal rat tissues: expression study and literature review. European Journal Of Histochemistry : Ejh. 2015;59(2):2458. PubMed |
| Podvin, Sonia; Miller, Miles C; Rossi, Ryan; Chukwueke, Jasmine; Donahue, John E; Johanson, Conrad E; Baird, Andrew; Stopa, Edward G. The Orphan C2orf40 Gene is a Neuroimmune Factor in Alzheimer's Disease. Jsm Alzheimer's Disease And Related Dementia. 3(1) PubMed |
| Cabuzu, Daniela; Ramakrishnan, Suresh K; Moor, Matthias B; Harmacek, Dusan; Auberson, Muriel; Durussel, Fanny; Bonny, Olivier. Loss of Ecrg4 improves calcium oxalate nephropathy. Plos One. 17(10):e0275972. PubMed |