Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Gene Sequence | HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Gene ID - Mouse | ENSMUSG00000056158 |
| Gene ID - Rat | ENSRNOG00000002626 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CA10 pAb (ATL-HPA054825) | |
| Datasheet | Anti CA10 pAb (ATL-HPA054825) Datasheet (External Link) |
| Vendor Page | Anti CA10 pAb (ATL-HPA054825) at Atlas Antibodies |
| Documents & Links for Anti CA10 pAb (ATL-HPA054825) | |
| Datasheet | Anti CA10 pAb (ATL-HPA054825) Datasheet (External Link) |
| Vendor Page | Anti CA10 pAb (ATL-HPA054825) |
| Citations for Anti CA10 pAb (ATL-HPA054825) – 2 Found |
| Sterky, Fredrik H; Trotter, Justin H; Lee, Sung-Jin; Recktenwald, Christian V; Du, Xiao; Zhou, Bo; Zhou, Peng; Schwenk, Jochen; Fakler, Bernd; Südhof, Thomas C. Carbonic anhydrase-related protein CA10 is an evolutionarily conserved pan-neurexin ligand. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(7):E1253-E1262. PubMed |
| Montoliu-Gaya, Laia; Tietze, Daniel; Kaminski, Debora; Mirgorodskaya, Ekaterina; Tietze, Alesia A; Sterky, Fredrik H. CA10 regulates neurexin heparan sulfate addition via a direct binding in the secretory pathway. Embo Reports. 2021;22(4):e51349. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Gene Sequence | HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Gene ID - Mouse | ENSMUSG00000056158 |
| Gene ID - Rat | ENSRNOG00000002626 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CA10 pAb (ATL-HPA054825) | |
| Datasheet | Anti CA10 pAb (ATL-HPA054825) Datasheet (External Link) |
| Vendor Page | Anti CA10 pAb (ATL-HPA054825) at Atlas Antibodies |
| Documents & Links for Anti CA10 pAb (ATL-HPA054825) | |
| Datasheet | Anti CA10 pAb (ATL-HPA054825) Datasheet (External Link) |
| Vendor Page | Anti CA10 pAb (ATL-HPA054825) |
| Citations for Anti CA10 pAb (ATL-HPA054825) – 2 Found |
| Sterky, Fredrik H; Trotter, Justin H; Lee, Sung-Jin; Recktenwald, Christian V; Du, Xiao; Zhou, Bo; Zhou, Peng; Schwenk, Jochen; Fakler, Bernd; Südhof, Thomas C. Carbonic anhydrase-related protein CA10 is an evolutionarily conserved pan-neurexin ligand. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(7):E1253-E1262. PubMed |
| Montoliu-Gaya, Laia; Tietze, Daniel; Kaminski, Debora; Mirgorodskaya, Ekaterina; Tietze, Alesia A; Sterky, Fredrik H. CA10 regulates neurexin heparan sulfate addition via a direct binding in the secretory pathway. Embo Reports. 2021;22(4):e51349. PubMed |