Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: carbonic anhydrase X
Gene Name: CA10
Alternative Gene Name: CA-RPX, CARPX, HUCEP-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056158: 100%, ENSRNOG00000002626: 100%
Entrez Gene ID: 56934
Uniprot ID: Q9NS85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	ICC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Gene Sequence	PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Gene ID - Mouse	ENSMUSG00000056158
Gene ID - Rat	ENSRNOG00000002626
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CA10 pAb (ATL-HPA057837)
Datasheet	Anti CA10 pAb (ATL-HPA057837) Datasheet (External Link)
Vendor Page	Anti CA10 pAb (ATL-HPA057837) at Atlas Antibodies

Documents & Links for Anti CA10 pAb (ATL-HPA057837)
Datasheet	Anti CA10 pAb (ATL-HPA057837) Datasheet (External Link)
Vendor Page	Anti CA10 pAb (ATL-HPA057837)

Citations for Anti CA10 pAb (ATL-HPA057837) – 1 Found

Tao, Bangbao; Ling, Yiqun; Zhang, Youyou; Li, Shu; Zhou, Ping; Wang, Xiaoqiang; Li, Bin; Jun, Zhong; Zhang, Wenchuan; Xu, Chunyan; Shi, Juanhong; Wang, Lifeng; Zhang, Wenhao; Li, Shiting. CA10 and CA11 negatively regulate neuronal activity-dependent growth of gliomas. Molecular Oncology. 2019;13(5):1018-1032. PubMed

No related products found

Reviews 0

Reviews

Anti CA10 pAb (ATL-HPA057837)

Additional information

Specifications

Reviews 0

Anti CA10 pAb (ATL-HPA057837)

Additional information

Specifications

No related products found

Anti CA10 pAb (ATL-HPA057837)

Additional information

Anti CA10 pAb (ATL-HPA057837)

Additional information

Specifications

Specifications