Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD |
| Gene Sequence | MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD |
| Gene ID - Mouse | ENSMUSG00000029761 |
| Gene ID - Rat | ENSRNOG00000010233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) | |
| Datasheet | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) | |
| Datasheet | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) |
| Citations for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) – 3 Found |
| Köhler, Christoph N. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2011;59(5):504-17. PubMed |
| Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. PubMed |
| Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD |
| Gene Sequence | MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD |
| Gene ID - Mouse | ENSMUSG00000029761 |
| Gene ID - Rat | ENSRNOG00000010233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) | |
| Datasheet | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) | |
| Datasheet | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) |
| Citations for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) – 3 Found |
| Köhler, Christoph N. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2011;59(5):504-17. PubMed |
| Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. PubMed |
| Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |