Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44234/23248/atl-hpa017206_anti-camk4-pab-atl-hpa017206_33981__15272.1783626844.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS |
| Gene Sequence | GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS |
| Gene ID - Mouse | ENSMUSG00000038128 |
| Gene ID - Rat | ENSRNOG00000020478 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAMK4 pAb (ATL-HPA017206) | |
| Datasheet | Anti CAMK4 pAb (ATL-HPA017206) Datasheet (External Link) |
| Vendor Page | Anti CAMK4 pAb (ATL-HPA017206) at Atlas Antibodies |
| Documents & Links for Anti CAMK4 pAb (ATL-HPA017206) | |
| Datasheet | Anti CAMK4 pAb (ATL-HPA017206) Datasheet (External Link) |
| Vendor Page | Anti CAMK4 pAb (ATL-HPA017206) |
| Citations for Anti CAMK4 pAb (ATL-HPA017206) – 2 Found |
| Harrison, Benjamin J; Flight, Robert M; Gomes, Cynthia; Venkat, Gayathri; Ellis, Steven R; Sankar, Uma; Twiss, Jeffery L; Rouchka, Eric C; Petruska, Jeffrey C. IB4-binding sensory neurons in the adult rat express a novel 3' UTR-extended isoform of CaMK4 that is associated with its localization to axons. The Journal Of Comparative Neurology. 2014;522(2):308-36. PubMed |
| Duda, Przemysław; Wójtowicz, Tomasz; Janczara, Jakub; Krowarsch, Daniel; Czyrek, Aleksandra; Gizak, Agnieszka; Rakus, Dariusz. Fructose 1,6-Bisphosphatase 2 Plays a Crucial Role in the Induction and Maintenance of Long-Term Potentiation. Cells. 2020;9(6) PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS |
| Gene Sequence | GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS |
| Gene ID - Mouse | ENSMUSG00000038128 |
| Gene ID - Rat | ENSRNOG00000020478 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAMK4 pAb (ATL-HPA017206) | |
| Datasheet | Anti CAMK4 pAb (ATL-HPA017206) Datasheet (External Link) |
| Vendor Page | Anti CAMK4 pAb (ATL-HPA017206) at Atlas Antibodies |
| Documents & Links for Anti CAMK4 pAb (ATL-HPA017206) | |
| Datasheet | Anti CAMK4 pAb (ATL-HPA017206) Datasheet (External Link) |
| Vendor Page | Anti CAMK4 pAb (ATL-HPA017206) |
| Citations for Anti CAMK4 pAb (ATL-HPA017206) – 2 Found |
| Harrison, Benjamin J; Flight, Robert M; Gomes, Cynthia; Venkat, Gayathri; Ellis, Steven R; Sankar, Uma; Twiss, Jeffery L; Rouchka, Eric C; Petruska, Jeffrey C. IB4-binding sensory neurons in the adult rat express a novel 3' UTR-extended isoform of CaMK4 that is associated with its localization to axons. The Journal Of Comparative Neurology. 2014;522(2):308-36. PubMed |
| Duda, Przemysław; Wójtowicz, Tomasz; Janczara, Jakub; Krowarsch, Daniel; Czyrek, Aleksandra; Gizak, Agnieszka; Rakus, Dariusz. Fructose 1,6-Bisphosphatase 2 Plays a Crucial Role in the Induction and Maintenance of Long-Term Potentiation. Cells. 2020;9(6) PubMed |