Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44862/24450/atl-hpa019639_anti-cant1-pab-atl-hpa019639-wenhanced-validation_35222__73023.1783627721.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
| Gene Sequence | QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
| Gene ID - Mouse | ENSMUSG00000025575 |
| Gene ID - Rat | ENSRNOG00000003239 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) | |
| Datasheet | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) | |
| Datasheet | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) |
| Citations for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) – 3 Found |
| Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Wang, Jiachen; Wang, Zhao; Yuan, Jiaxiang; Wang, Jiaxiang; Shen, Xinsheng. The positive feedback between ACSL4 expression and O-GlcNAcylation contributes to the growth and survival of hepatocellular carcinoma. Aging. 2020;12(9):7786-7800. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
| Gene Sequence | QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
| Gene ID - Mouse | ENSMUSG00000025575 |
| Gene ID - Rat | ENSRNOG00000003239 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) | |
| Datasheet | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) | |
| Datasheet | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) |
| Citations for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) – 3 Found |
| Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Wang, Jiachen; Wang, Zhao; Yuan, Jiaxiang; Wang, Jiaxiang; Shen, Xinsheng. The positive feedback between ACSL4 expression and O-GlcNAcylation contributes to the growth and survival of hepatocellular carcinoma. Aging. 2020;12(9):7786-7800. PubMed |