Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47863/30134/atl-hpa030124_anti-cap1-pab-atl-hpa030124_41067__06272.1783631877.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Gene Sequence | VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Gene ID - Mouse | ENSMUSG00000028656 |
| Gene ID - Rat | ENSRNOG00000013492 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAP1 pAb (ATL-HPA030124) | |
| Datasheet | Anti CAP1 pAb (ATL-HPA030124) Datasheet (External Link) |
| Vendor Page | Anti CAP1 pAb (ATL-HPA030124) at Atlas Antibodies |
| Documents & Links for Anti CAP1 pAb (ATL-HPA030124) | |
| Datasheet | Anti CAP1 pAb (ATL-HPA030124) Datasheet (External Link) |
| Vendor Page | Anti CAP1 pAb (ATL-HPA030124) |
| Citations for Anti CAP1 pAb (ATL-HPA030124) – 2 Found |
| Rosendahl, Ann H; Bergqvist, Malin; Lettiero, Barbara; Kimbung, Siker; Borgquist, Signe. Adipocytes and Obesity-Related Conditions Jointly Promote Breast Cancer Cell Growth and Motility: Associations With CAP1 for Prognosis. Frontiers In Endocrinology. 9( 30524378):689. PubMed |
| Bergqvist, Malin; Elebro, Karin; Sandsveden, Malte; Borgquist, Signe; Rosendahl, Ann H. Effects of tumor-specific CAP1 expression and body constitution on clinical outcomes in patients with early breast cancer. Breast Cancer Research : Bcr. 2020;22(1):67. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Gene Sequence | VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Gene ID - Mouse | ENSMUSG00000028656 |
| Gene ID - Rat | ENSRNOG00000013492 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAP1 pAb (ATL-HPA030124) | |
| Datasheet | Anti CAP1 pAb (ATL-HPA030124) Datasheet (External Link) |
| Vendor Page | Anti CAP1 pAb (ATL-HPA030124) at Atlas Antibodies |
| Documents & Links for Anti CAP1 pAb (ATL-HPA030124) | |
| Datasheet | Anti CAP1 pAb (ATL-HPA030124) Datasheet (External Link) |
| Vendor Page | Anti CAP1 pAb (ATL-HPA030124) |
| Citations for Anti CAP1 pAb (ATL-HPA030124) – 2 Found |
| Rosendahl, Ann H; Bergqvist, Malin; Lettiero, Barbara; Kimbung, Siker; Borgquist, Signe. Adipocytes and Obesity-Related Conditions Jointly Promote Breast Cancer Cell Growth and Motility: Associations With CAP1 for Prognosis. Frontiers In Endocrinology. 9( 30524378):689. PubMed |
| Bergqvist, Malin; Elebro, Karin; Sandsveden, Malte; Borgquist, Signe; Rosendahl, Ann H. Effects of tumor-specific CAP1 expression and body constitution on clinical outcomes in patients with early breast cancer. Breast Cancer Research : Bcr. 2020;22(1):67. PubMed |