Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44610/23942/atl-hpa018843_anti-capg-pab-atl-hpa018843-wenhanced-validation_34702__55152.1783627355.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQF |
| Gene Sequence | SSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQF |
| Gene ID - Mouse | ENSMUSG00000056737 |
| Gene ID - Rat | ENSRNOG00000013668 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) | |
| Datasheet | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) | |
| Datasheet | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) |
| Citations for Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQF |
| Gene Sequence | SSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQF |
| Gene ID - Mouse | ENSMUSG00000056737 |
| Gene ID - Rat | ENSRNOG00000013668 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) | |
| Datasheet | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) | |
| Datasheet | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) |
| Citations for Anti CAPG pAb (ATL-HPA018843 w/enhanced validation) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |