Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: caspase recruitment domain family, member 19
Gene Name: CARD19
Alternative Gene Name: bA370F5.1, BinCARD, C9orf89, MGC11115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037960: 88%, ENSRNOG00000016560: 85%
Entrez Gene ID: 84270
Uniprot ID: Q96LW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	ICC, IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNR
Gene Sequence	MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNR
Gene ID - Mouse	ENSMUSG00000037960
Gene ID - Rat	ENSRNOG00000016560
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CARD19 pAb (ATL-HPA010990)
Datasheet	Anti CARD19 pAb (ATL-HPA010990) Datasheet (External Link)
Vendor Page	Anti CARD19 pAb (ATL-HPA010990) at Atlas Antibodies

Documents & Links for Anti CARD19 pAb (ATL-HPA010990)
Datasheet	Anti CARD19 pAb (ATL-HPA010990) Datasheet (External Link)
Vendor Page	Anti CARD19 pAb (ATL-HPA010990)

Citations for Anti CARD19 pAb (ATL-HPA010990) – 2 Found

Rios, Kariana E; Kashyap, Anuj K; Maynard, Sean K; Washington, Michael; Paul, Suman; Schaefer, Brian C. CARD19, the protein formerly known as BinCARD, is a mitochondrial protein that does not regulate Bcl10-dependent NF-κB activation after TCR engagement. Cellular Immunology. 2020;356( 32763502):104179. PubMed

Rios, Kariana E; Zhou, Ming; Lott, Nathaniel M; Beauregard, Chelsi R; McDaniel, Dennis P; Conrads, Thomas P; Schaefer, Brian C. CARD19 Interacts with Mitochondrial Contact Site and Cristae Organizing System Constituent Proteins and Regulates Cristae Morphology. Cells. 2022;11(7) PubMed

No related products found

Reviews 0

Reviews

Anti CARD19 pAb (ATL-HPA010990)

Additional information

Anti CARD19 pAb (ATL-HPA010990)

Additional information

Specifications

No related products found

Reviews 0

Anti CARD19 pAb (ATL-HPA010990)

Additional information

Specifications

Anti CARD19 pAb (ATL-HPA010990)

Additional information

Specifications

Specifications