Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47036/28613/atl-hpa027956_anti-cbl-pab-atl-hpa027956-wenhanced-validation_39480__76195.1783630781.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA |
| Gene Sequence | PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA |
| Gene ID - Mouse | ENSMUSG00000034342 |
| Gene ID - Rat | ENSRNOG00000008444 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) | |
| Datasheet | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) | |
| Datasheet | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) |
| Citations for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) – 2 Found |
| He, Qing-Lin; Qin, Shan-Yu; Tao, Lin; Ning, Hong-Jian; Jiang, Hai-Xing. Prognostic value and prospective molecular mechanism of miR-100-5p in hepatocellular carcinoma: A comprehensive study based on 1,258 samples. Oncology Letters. 2019;18(6):6126-6142. PubMed |
| Rodriguez-Polo, Ignacio; Nielsen, Maike; Debowski, Katharina; Behr, Rüdiger. The ubiquitin ligase c-CBL is expressed in undifferentiated marmoset monkey pluripotent stem cells but is not a general stem cell marker. Primate Biology. 4(2):231-240. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA |
| Gene Sequence | PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA |
| Gene ID - Mouse | ENSMUSG00000034342 |
| Gene ID - Rat | ENSRNOG00000008444 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) | |
| Datasheet | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) | |
| Datasheet | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBL pAb (ATL-HPA027956 w/enhanced validation) |
| Citations for Anti CBL pAb (ATL-HPA027956 w/enhanced validation) – 2 Found |
| He, Qing-Lin; Qin, Shan-Yu; Tao, Lin; Ning, Hong-Jian; Jiang, Hai-Xing. Prognostic value and prospective molecular mechanism of miR-100-5p in hepatocellular carcinoma: A comprehensive study based on 1,258 samples. Oncology Letters. 2019;18(6):6126-6142. PubMed |
| Rodriguez-Polo, Ignacio; Nielsen, Maike; Debowski, Katharina; Behr, Rüdiger. The ubiquitin ligase c-CBL is expressed in undifferentiated marmoset monkey pluripotent stem cells but is not a general stem cell marker. Primate Biology. 4(2):231-240. PubMed |