Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45449/25611/atl-hpa021773_anti-cbll1-pab-atl-hpa021773-wenhanced-validation_36407__78913.1783628569.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP |
| Gene Sequence | RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP |
| Gene ID - Mouse | ENSMUSG00000020659 |
| Gene ID - Rat | ENSRNOG00000007253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) | |
| Datasheet | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) | |
| Datasheet | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) |
| Citations for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) – 1 Found |
| Hui, Linping; Zhang, Siyang; Wudu, Muli; Ren, Hongjiu; Xu, Yitong; Zhang, Qingfu; Qiu, Xueshan. CBLL1 is highly expressed in non-small cell lung cancer and promotes cell proliferation and invasion. Thoracic Cancer. 2019;10(6):1479-1488. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP |
| Gene Sequence | RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP |
| Gene ID - Mouse | ENSMUSG00000020659 |
| Gene ID - Rat | ENSRNOG00000007253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) | |
| Datasheet | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) | |
| Datasheet | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) |
| Citations for Anti CBLL1 pAb (ATL-HPA021773 w/enhanced validation) – 1 Found |
| Hui, Linping; Zhang, Siyang; Wudu, Muli; Ren, Hongjiu; Xu, Yitong; Zhang, Qingfu; Qiu, Xueshan. CBLL1 is highly expressed in non-small cell lung cancer and promotes cell proliferation and invasion. Thoracic Cancer. 2019;10(6):1479-1488. PubMed |