Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44529/23789/atl-hpa018434_anti-cbr3-pab-atl-hpa018434_34546__13474.1783627242.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44529/23789/atl-hpa018434_anti-cbr3-pab-atl-hpa018434_34546__13474.1783627242.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
| Gene Sequence | DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
| Gene ID - Mouse | ENSMUSG00000022947 |
| Gene ID - Rat | ENSRNOG00000001701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBR3 pAb (ATL-HPA018434) | |
| Datasheet | Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link) |
| Vendor Page | Anti CBR3 pAb (ATL-HPA018434) at Atlas Antibodies |
| Documents & Links for Anti CBR3 pAb (ATL-HPA018434) | |
| Datasheet | Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link) |
| Vendor Page | Anti CBR3 pAb (ATL-HPA018434) |
Try browsing our complete catalog of products.
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44529/23789/atl-hpa018434_anti-cbr3-pab-atl-hpa018434_34546__13474.1783627242.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44529/23789/atl-hpa018434_anti-cbr3-pab-atl-hpa018434_34546__13474.1783627242.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
| Gene Sequence | DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
| Gene ID - Mouse | ENSMUSG00000022947 |
| Gene ID - Rat | ENSRNOG00000001701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CBR3 pAb (ATL-HPA018434) | |
| Datasheet | Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link) |
| Vendor Page | Anti CBR3 pAb (ATL-HPA018434) at Atlas Antibodies |
| Documents & Links for Anti CBR3 pAb (ATL-HPA018434) | |
| Datasheet | Anti CBR3 pAb (ATL-HPA018434) Datasheet (External Link) |
| Vendor Page | Anti CBR3 pAb (ATL-HPA018434) |